You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification |
---|
Name | Plasma membrane ATPase proteolipid 1 |
---|
Synonyms | Not Available |
---|
Gene Name | PMP1 |
---|
Enzyme Class | Not Available |
---|
Biological Properties |
---|
General Function | Involved in enzyme regulator activity |
---|
Specific Function | Not Available |
---|
Cellular Location | Cell membrane |
---|
SMPDB Pathways | Not Available |
---|
KEGG Pathways | Not Available |
---|
SMPDB Reactions | Not Available |
---|
KEGG Reactions | Not Available |
---|
Metabolites | |
---|
GO Classification | Not Available |
---|
Gene Properties |
---|
Chromosome Location | Not Available |
---|
Locus | |
---|
Gene Sequence | >123 bp
ATGACTTTACCAGGTGGTGTTATTTTAGTTTTCATTTTGGTCGGTTTGGCTTGTATTGCC
ATTATTGCTACCATTATCTACAGAAAATGGCAAGCTAGACAAAGAGGATTGCAAAGATTC
TAA |
---|
Protein Properties |
---|
Pfam Domain Function | |
---|
Protein Residues | 40 |
---|
Protein Molecular Weight | 4500.5 |
---|
Protein Theoretical pI | 12.06 |
---|
Signalling Regions | |
---|
Transmembrane Regions | |
---|
Protein Sequence | >Plasma membrane ATPase proteolipid 1
MTLPGGVILVFILVGLACIAIIATIIYRKWQARQRGLQRF |
---|
References |
---|
External Links | |
---|
General Reference | - Navarre, C., Ghislain, M., Leterme, S., Ferroud, C., Dufour, J. P., Goffeau, A. (1992). "Purification and complete sequence of a small proteolipid associated with the plasma membrane H(+)-ATPase of Saccharomyces cerevisiae." J Biol Chem 267:6425-6428.1532582
- Oliver, S. G., van der Aart, Q. J., Agostoni-Carbone, M. L., Aigle, M., Alberghina, L., Alexandraki, D., Antoine, G., Anwar, R., Ballesta, J. P., Benit, P., et, a. l. .. (1992). "The complete DNA sequence of yeast chromosome III." Nature 357:38-46.1574125
- Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
|
---|