You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameRibose-phosphate pyrophosphokinase 1
Synonyms
  • Phosphoribosyl pyrophosphate synthase 1
Gene NamePRS1
Enzyme Class
Biological Properties
General FunctionInvolved in magnesium ion binding
Specific Function5-phosphoribose 1-diphosphate synthase involved in nucleotide, histidine, and tryptophan biosynthesis. Active in heteromultimeric complexes with other 5-phosphoribose 1- diphosphate synthases (PRS2, PRS3, PRS4 and PRS5)
Cellular LocationCytoplasm
SMPDB Pathways
Histidine BiosynthesisPW002418 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Pentose phosphate pathwayec00030 Map00030
Purine metabolismec00230 Map00230
SMPDB Reactions
D-Ribose 5-phosphate + Adenosine triphosphateAdenosine monophosphate + hydron + Phosphoribosyl pyrophosphate
KEGG Reactions
Adenosine triphosphate + alpha-D-ribose 5-phosphateAdenosine monophosphate + hydron + Phosphoribosyl pyrophosphate
Metabolites
YMDB IDNameView
YMDB00097Adenosine monophosphateShow
YMDB00109Adenosine triphosphateShow
YMDB00119D-Ribose 5-phosphateShow
YMDB00402Phosphoribosyl pyrophosphateShow
YMDB00650alpha-D-ribose 5-phosphateShow
YMDB00862hydronShow
GO Classification
Component
Not Available
Function
diphosphotransferase activity
catalytic activity
ribose phosphate diphosphokinase activity
transferase activity
binding
ion binding
transferase activity, transferring phosphorus-containing groups
cation binding
metal ion binding
magnesium ion binding
Process
nucleotide biosynthetic process
biosynthetic process
ribonucleoside monophosphate biosynthetic process
metabolic process
nitrogen compound metabolic process
cellular nitrogen compound metabolic process
nucleobase, nucleoside, nucleotide and nucleic acid metabolic process
cellular biosynthetic process
nucleobase, nucleoside and nucleotide metabolic process
nucleoside monophosphate metabolic process
nucleoside phosphate metabolic process
nucleoside monophosphate biosynthetic process
nucleotide metabolic process
Gene Properties
Chromosome Locationchromosome 11
LocusYKL181W
Gene Sequence>1284 bp ATGCGTAAGTGTAAAATTTTTGTTGGTAACTCTCACCCAGAGTTGGGTAATATGGTTTGC CAAAGATTAGGTATCGAACCAGCTCCATGTACATTAAAAAAATTTGCAAATGGTGAAACG TCAGTTCAAATCGGTGTATCTGTTCGTGACGAAGATGTGTATGTCATTCAATCTGGTTCT CCATCCATAAATGATGACATTATGGAACTGTTGATTTTAGTTTCTGCCTGTAGGGGCGGA TCTGCTAGGAAAATTACAGCAGTCATTCCTCAATTTCCTTACTCTAAACAATGTAAAATG AAGAGACACAGAGGCGCTATTACTGCAAGGATGTTGGCCAATCTGTTGGTCATGGCTGGC GCTGATCATGTTGTGTCTATGGACCTTCATGCTTCTCAAATGCAGGGGTTTTTCACCAAA CCAGTCGATAACCTATACGGGGGCCCTAGTTTAGCGAAATGGATTAGAGAAAATGTTGAA GACTATGAAGATGCAGTAGTTGTCTCTAAGAATCCAGGTGGTACTAAAAGAGTTACAGCC CTGGCGGATTCTTTGAAGATCAACTTTGCTATGATCCATACTGATCGTCGTCGTTCTAAG GATCTGTATTCTCAAAACAAGGATTTGCAACAACTAAAGTTGAGAAAGCAATCAATGTTG AGGAAAAATAGACCGATCATCAGACAAGGTGACCATCCAAATGAGGAGGAAAACATTATT TTAAGTAACGGTATTCAAACTGCTAGGATCCGTAACGGCCACGTTATCGGTGACGATGAG GCAGACGATGATGAAGACGCTATCTTAGAATCTGACAGCGAATTGCATTCTATTGATGGC TTAGACTCGCATGGCTTGGGCGGTACATATGATGCTGTCGACTCCGAAGACGAAGAGGAA ATCCCAGTTCTCTATAGGGAACAACTGATTACATTGGTCGGAAACGTCCGTGGTCGCTCT GCCATCATTCTAGATGATATGATTGATAGACCTGGGTCATTTATTAGCGCTGCTGAACAT TTGGTGCAAAATTGTGGTGCCAAAAAGGTTTATGTTGTTGCTACTCACGGTATATTCACT GGAGACTGTTTGGAAGAACTTGAAAAGTCCGATGCCATTGACACAATTGTGGTCACAAAT ACATATCCGATTTCTGGCGAACGCATAGCTGGGTCCAAGAAATTGGTTACTATCGATGTT TCTCCAATTTTCGCAGAATGTATCCGTCGTGATCATTATGGTGAGAGTATTTCCGTTTTA TTTGACTCTTTGGCAGCTCTGTAA
Protein Properties
Pfam Domain FunctionNot Available
Protein Residues427
Protein Molecular Weight47047.0
Protein Theoretical pI5.47
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Ribose-phosphate pyrophosphokinase 1 MRKCKIFVGNSHPELGNMVCQRLGIEPAPCTLKKFANGETSVQIGVSVRDEDVYVIQSGS PSINDDIMELLILVSACRGGSARKITAVIPQFPYSKQCKMKRHRGAITARMLANLLVMAG ADHVVSMDLHASQMQGFFTKPVDNLYGGPSLAKWIRENVEDYEDAVVVSKNPGGTKRVTA LADSLKINFAMIHTDRRRSKDLYSQNKDLQQLKLRKQSMLRKNRPIIRQGDHPNEEENII LSNGIQTARIRNGHVIGDDEADDDEDAILESDSELHSIDGLDSHGLGGTYDAVDSEDEEE IPVLYREQLITLVGNVRGRSAIILDDMIDRPGSFISAAEHLVQNCGAKKVYVVATHGIFT GDCLEELEKSDAIDTIVVTNTYPISGERIAGSKKLVTIDVSPIFAECIRRDHYGESISVL FDSLAAL
References
External Links
ResourceLink
Saccharomyces Genome Database PRS1
Uniprot IDP32895
Uniprot NameKPR1_YEAST
GenBank Gene IDL04130
Genebank Protein ID172274
General Reference
  • Blacketer, M. J., Madaule, P., Myers, A. M. (1994). "The Saccharomyces cerevisiae mutation elm4-1 facilitates pseudohyphal differentiation and interacts with a deficiency in phosphoribosylpyrophosphate synthase activity to cause constitutive pseudohyphal growth." Mol Cell Biol 14:4671-4681.8007970
  • Carter, A. T., Narbad, A., Pearson, B. M., Beck, K. F., Logghe, M., Contreras, R., Schweizer, M. (1994). "Phosphoribosylpyrophosphate synthetase (PRS): a new gene family in Saccharomyces cerevisiae." Yeast 10:1031-1044.7992503
  • Wiemann, S., Voss, H., Schwager, C., Rupp, T., Stegemann, J., Zimmermann, J., Grothues, D., Sensen, C., Erfle, H., Hewitt, N., et, a. l. .. (1993). "Sequencing and analysis of 51.6 kilobases on the left arm of chromosome XI from Saccharomyces cerevisiae reveals 23 open reading frames including the FAS1 gene." Yeast 9:1343-1348.8154185
  • Dujon, B., Alexandraki, D., Andre, B., Ansorge, W., Baladron, V., Ballesta, J. P., Banrevi, A., Bolle, P. A., Bolotin-Fukuhara, M., Bossier, P., et, a. l. .. (1994). "Complete DNA sequence of yeast chromosome XI." Nature 369:371-378.8196765
  • Carter, A. T., Beiche, F., Hove-Jensen, B., Narbad, A., Barker, P. J., Schweizer, L. M., Schweizer, M. (1997). "PRS1 is a key member of the gene family encoding phosphoribosylpyrophosphate synthetase in Saccharomyces cerevisiae." Mol Gen Genet 254:148-156.9108276
  • Hernando, Y., Carter, A. T., Parr, A., Hove-Jensen, B., Schweizer, M. (1999). "Genetic analysis and enzyme activity suggest the existence of more than one minimal functional unit capable of synthesizing phosphoribosyl pyrophosphate in Saccharomyces cerevisiae." J Biol Chem 274:12480-12487.10212224
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Hove-Jensen, B. (2004). "Heterooligomeric phosphoribosyl diphosphate synthase of Saccharomyces cerevisiae: combinatorial expression of the five PRS genes in Escherichia coli." J Biol Chem 279:40345-40350.15280369
  • Chi, A., Huttenhower, C., Geer, L. Y., Coon, J. J., Syka, J. E., Bai, D. L., Shabanowitz, J., Burke, D. J., Troyanskaya, O. G., Hunt, D. F. (2007). "Analysis of phosphorylation sites on proteins from Saccharomyces cerevisiae by electron transfer dissociation (ETD) mass spectrometry." Proc Natl Acad Sci U S A 104:2193-2198.17287358
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956