You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameD-lactate dehydrogenase [cytochrome] 1, mitochondrial
Synonyms
  • D-lactate ferricytochrome C oxidoreductase
  • D-LCR
Gene NameDLD1
Enzyme Class
Biological Properties
General FunctionInvolved in catalytic activity
Specific FunctionCatalyzes the stereospecific oxidation of D-lactate to pyruvate
Cellular LocationMitochondrion inner membrane
SMPDB Pathways
Pyruvate metabolismPW002447 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Pyruvate metabolismec00620 Map00620
SMPDB Reactions
D-Lactic acid + ferricytochrome cPyruvic acid + Pentane + hydron
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00175Pyruvic acidShow
YMDB00287D-Lactic acidShow
YMDB00862hydronShow
YMDB16246PentaneShow
YMDB16255ferricytochrome cShow
GO Classification
Component
Not Available
Function
binding
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
FAD or FADH2 binding
oxidoreductase activity
catalytic activity
Process
Not Available
Gene Properties
Chromosome Locationchromosome 4
LocusYDL174C
Gene Sequence>1764 bp ATGTTGTGGAAGCGTACTTGCACAAGGCTAATAAAGCCTATTGCACAACCTAGAGGAAGG CTGGTGAGAAGATCATGCTACAGATACGCCTCAACAGGCACAGGCAGCACCGACAGCAGC AGCCAGTGGTTAAAATACTCTGTCATCGCCTCTTCAGCTACTCTATTCGGTTATTTGTTC GCTAAGAACCTCTATTCTAGGGAGACTAAGGAAGATTTGATAGAGAAGCTGGAAATGGTC AAAAAGATCGACCCAGTAAATTCTACGTTAAAGCTGTCCTCATTGGACTCACCAGACTAT TTGCACGACCCGGTTAAGATCGATAAGGTTGTTGAGGACCTGAAGCAGGTGCTGGGAAAC AAGCCTGAAAACTACTCTGATGCGAAATCCGATTTGGACGCCCATTCAGATACCTACTTC AACACGCATCACCCCTCTCCCGAGCAAAGACCTAGGATTATATTATTCCCTCATACTACC GAAGAAGTTTCCAAAATTTTGAAAATATGTCACGATAACAACATGCCAGTTGTACCCTTC TCGGGCGGAACGTCCTTGGAGGGGCACTTCCTGCCTACAAGAATTGGAGATACCATAACC GTAGACCTGTCCAAGTTTATGAATAACGTCGTAAAATTTGACAAGCTGGACCTGGACATC ACCGTGCAGGCCGGTCTACCCTGGGAGGATTTGAATGACTATTTGAGCGACCACGGTTTG ATGTTTGGCTGTGACCCTGGTCCAGGTGCACAGATTGGTGGTTGCATTGCTAATTCTTGT TCAGGAACCAACGCCTACCGTTACGGTACCATGAAGGAGAATATTATAAACATGACTATA GTGTTGCCGGACGGGACCATTGTCAAGACGAAGAAAAGACCCAGAAAGTCGAGCGCTGGC TATAACTTAAATGGTTTATTTGTGGGAAGTGAAGGTACCTTAGGTATTGTTACTGAAGCT ACTGTCAAGTGTCATGTCAAGCCCAAAGCTGAAACTGTTGCGGTGGTATCCTTTGATACT ATCAAGGATGCGGCCGCATGTGCTTCTAATCTGACTCAGAGTGGTATTCATTTGAACGCC ATGGAGTTACTGGATGAAAATATGATGAAGTTGATCAACGCATCTGAATCCACGGACAGA TGTGATTGGGTAGAGAAACCAACTATGTTTTTCAAGATTGGTGGGAGATCTCCCAACATT GTCAATGCTCTTGTGGATGAAGTTAAGGCTGTCGCCCAGTTAAATCACTGCAACAGTTTT CAGTTTGCTAAAGATGATGACGAAAAATTGGAATTATGGGAAGCTAGAAAGGTCGCGCTA TGGTCTGTGCTAGACGCTGATAAGAGCAAAGACAAATCAGCTAAAATTTGGACAACTGAT GTAGCTGTTCCTGTGTCGCAGTTCGACAAGGTTATTCACGAAACTAAAAAGGACATGCAA GCTAGTAAGCTGATCAACGCCATTGTTGGTCATGCAGGTGATGGTAACTTCCATGCATTC ATCGTCTACAGAACCCCTGAAGAACACGAAACCTGTAGCCAACTTGTTGACAGAATGGTC AAGAGAGCACTGAACGCAGAAGGCACTTGCACGGGTGAACACGGTGTTGGTATTGGTAAA AGAGAGTACTTGCTCGAAGAATTAGGTGAAGCACCCGTCGATTTGATGAGAAAGATTAAG CTAGCTATTGACCCAAAGAGAATCATGAACCCGGACAAAATCTTTAAAACTGATCCAAAC GAGCCCGCTAATGATTACAGGTGA
Protein Properties
Pfam Domain Function
Protein Residues587
Protein Molecular Weight65291.89844
Protein Theoretical pI6.82
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>D-lactate dehydrogenase [cytochrome] 1, mitochondrial MLWKRTCTRLIKPIAQPRGRLVRRSCYRYASTGTGSTDSSSQWLKYSVIASSATLFGYLF AKNLYSRETKEDLIEKLEMVKKIDPVNSTLKLSSLDSPDYLHDPVKIDKVVEDLKQVLGN KPENYSDAKSDLDAHSDTYFNTHHPSPEQRPRIILFPHTTEEVSKILKICHDNNMPVVPF SGGTSLEGHFLPTRIGDTITVDLSKFMNNVVKFDKLDLDITVQAGLPWEDLNDYLSDHGL MFGCDPGPGAQIGGCIANSCSGTNAYRYGTMKENIINMTIVLPDGTIVKTKKRPRKSSAG YNLNGLFVGSEGTLGIVTEATVKCHVKPKAETVAVVSFDTIKDAAACASNLTQSGIHLNA MELLDENMMKLINASESTDRCDWVEKPTMFFKIGGRSPNIVNALVDEVKAVAQLNHCNSF QFAKDDDEKLELWEARKVALWSVLDADKSKDKSAKIWTTDVAVPVSQFDKVIHETKKDMQ ASKLINAIVGHAGDGNFHAFIVYRTPEEHETCSQLVDRMVKRALNAEGTCTGEHGVGIGK REYLLEELGEAPVDLMRKIKLAIDPKRIMNPDKIFKTDPNEPANDYR
References
External Links
ResourceLink
Saccharomyces Genome Database DLD1
Uniprot IDP32891
Uniprot NameDLD1_YEAST
GenBank Gene IDZ67750
Genebank Protein ID1061264
General Reference
  • Lodi, T., Ferrero, I. (1993). "Isolation of the DLD gene of Saccharomyces cerevisiae encoding the mitochondrial enzyme D-lactate ferricytochrome c oxidoreductase." Mol Gen Genet 238:315-324.8492799
  • Jacq, C., Alt-Morbe, J., Andre, B., Arnold, W., Bahr, A., Ballesta, J. P., Bargues, M., Baron, L., Becker, A., Biteau, N., Blocker, H., Blugeon, C., Boskovic, J., Brandt, P., Bruckner, M., Buitrago, M. J., Coster, F., Delaveau, T., del Rey, F., Dujon, B., Eide, L. G., Garcia-Cantalejo, J. M., Goffeau, A., Gomez-Peris, A., Zaccaria, P., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV." Nature 387:75-78.9169867
  • Grandier-Vazeille, X., Bathany, K., Chaignepain, S., Camougrand, N., Manon, S., Schmitter, J. M. (2001). "Yeast mitochondrial dehydrogenases are associated in a supramolecular complex." Biochemistry 40:9758-9769.11502169
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106