You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameLipoyl synthase, mitochondrial
Synonyms
  • Lipoate synthase
  • LS
  • Lip-syn
  • Lipoic acid synthase
Gene NameLIP5
Enzyme Class
Biological Properties
General FunctionInvolved in catalytic activity
Specific FunctionCatalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives (Probable)
Cellular LocationMitochondrion
SMPDB Pathways
Lipoic acid metabolismPW002499 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Lipoic acid metabolismec00785 Map00785
SMPDB Reactions
Octanoyl-[acyl-carrier protein] + S-Adenosyl-L-methionine + a sulfur donor → Lipoyl-ACP + L-Methionine + 2'-Deoxyadenosine
a sulfur donor + Protein N6-(octanoyl)lysine + S-Adenosyl-L-methionineL-Methionine + Protein N6-(lipoyl)lysine + 2'-Deoxyadenosine
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00121SulfideShow
YMDB001505'-DeoxyadenosineShow
YMDB00297S-AdenosylmethionineShow
YMDB00318L-MethionineShow
YMDB00438S-Adenosyl-L-methionineShow
YMDB005032'-DeoxyadenosineShow
GO Classification
Component
Not Available
Function
sulfurtransferase activity
lipoate synthase activity
binding
metal cluster binding
iron-sulfur cluster binding
4 iron, 4 sulfur cluster binding
catalytic activity
transferase activity, transferring sulfur-containing groups
transferase activity
Process
metabolic process
lipoic acid metabolic process
cellular metabolic process
lipoic acid biosynthetic process
lipoate biosynthetic process
cofactor metabolic process
coenzyme metabolic process
Gene Properties
Chromosome Locationchromosome 15
LocusYOR196C
Gene Sequence>1245 bp ATGTATAGACGATCTGTTGGAGTACTATTTGTTGGGAGAAATACAAGATGGATTTCGTCC ACTATTAGGTGTGGAACGAGCGCAACTCGGCCAATAAGATCCAATGCATTGAATACTGAT TCAGATAACGCTAGCGTTAGGGTACCAGTTGGAAATTCAACTGAGGTTGAAAATGCAACC AGTCAGTTAACAGGGACTTCGGGAAAAAGACGCAAGGGGAACAGAAAAAGAATTACAGAG TTCAAAGATGCTCTTAATTTGGGTCCATCTTTTGCAGATTTTGTTTCAGGTAAAGCTTCG AAAATGATCTTGGACCCTCTGGAGAAGGCAAGGCAAAATACAGAGGAAGCTAAAAAACTA CCTCGTTGGCTTAAGGTTCCTATTCCTAAGGGTACCAATTACCATAAATTGAAAGGCGAC GTAAAAGAATTAGGCCTGAGTACTGTTTGTGAGGAGGCAAGATGTCCCAATATTGGTGAA TGTTGGGGAGGCAAAGATAAATCTAAGGCAACGGCAACAATTATGCTGCTTGGTGATACT TGCACTCGTGGATGTAGGTTTTGTTCTGTGAAGACCAATAGAACGCCTAGTAAGCCGGAC CCAATGGAGCCCGAAAATACTGCCGAAGCTATCAAAAGATGGGGGTTGGGTTATGTTGTT TTAACTACCGTTGATAGGGACGATTTAGTCGATGGTGGTGCTAATCACCTGGCCGAGACG GTTCGCAAAATCAAACAGAAGGCACCAAATACTCTTGTAGAGACTCTTTCTGGTGATTTC AGAGGTGATTTGAAGATGGTGGACATTATGGCACAATGTGGGCTTGATGTTTACGCACAT AATTTGGAAACAGTTGAATCACTAACACCACATGTCAGAGACAGAAGAGCTACTTATAGA CAGTCTTTGAGTGTTTTAGAAAGGGCAAAAGCTACGGTTCCGTCACTGATTACTAAAACA TCAATAATGCTGGGTCTAGGAGAAACTGATGAGCAAATTACTCAAACTTTGAAGGATTTG CGCAATATTCAATGTGATGTTGTTACATTTGGTCAATATATGAGGCCAACCAAGAGACAT ATGAAAGTCGTAGAATATGTGAAACCCGAAAAGTTTGACTACTGGAAAGAGAGAGCTTTA GAGATGGGATTCTTGTATTGTGCATCTGGACCCCTAGTAAGATCGTCATATAAGGCTGGT GAAGCATTTATTGAGAACGTTTTGAAGAAAAGAAACATGAAATAA
Protein Properties
Pfam Domain Function
Protein Residues414
Protein Molecular Weight46246.80078
Protein Theoretical pI10.05
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Lipoyl synthase, mitochondrial MYRRSVGVLFVGRNTRWISSTIRCGTSATRPIRSNALNTDSDNASVRVPVGNSTEVENAT SQLTGTSGKRRKGNRKRITEFKDALNLGPSFADFVSGKASKMILDPLEKARQNTEEAKKL PRWLKVPIPKGTNYHKLKGDVKELGLSTVCEEARCPNIGECWGGKDKSKATATIMLLGDT CTRGCRFCSVKTNRTPSKPDPMEPENTAEAIKRWGLGYVVLTTVDRDDLVDGGANHLAET VRKIKQKAPNTLVETLSGDFRGDLKMVDIMAQCGLDVYAHNLETVESLTPHVRDRRATYR QSLSVLERAKATVPSLITKTSIMLGLGETDEQITQTLKDLRNIQCDVVTFGQYMRPTKRH MKVVEYVKPEKFDYWKERALEMGFLYCASGPLVRSSYKAGEAFIENVLKKRNMK
References
External Links
ResourceLink
Saccharomyces Genome Database LIP5
Uniprot IDP32875
Uniprot NameLIPA_YEAST
GenBank Gene IDAY558046
Genebank Protein ID45269982
General Reference
  • Sulo, P., Martin, N. C. (1993). "Isolation and characterization of LIP5. A lipoate biosynthetic locus of Saccharomyces cerevisiae." J Biol Chem 268:17634-17639.8349643
  • Dujon, B., Albermann, K., Aldea, M., Alexandraki, D., Ansorge, W., Arino, J., Benes, V., Bohn, C., Bolotin-Fukuhara, M., Bordonne, R., Boyer, J., Camasses, A., Casamayor, A., Casas, C., Cheret, G., Cziepluch, C., Daignan-Fornier, B., Dang, D. V., de Haan, M., Delius, H., Durand, P., Fairhead, C., Feldmann, H., Gaillon, L., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XV." Nature 387:98-102.9169874
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Sickmann, A., Reinders, J., Wagner, Y., Joppich, C., Zahedi, R., Meyer, H. E., Schonfisch, B., Perschil, I., Chacinska, A., Guiard, B., Rehling, P., Pfanner, N., Meisinger, C. (2003). "The proteome of Saccharomyces cerevisiae mitochondria." Proc Natl Acad Sci U S A 100:13207-13212.14576278
  • Schonauer, M. S., Kastaniotis, A. J., Kursu, V. A., Hiltunen, J. K., Dieckmann, C. L. (2009). "Lipoic acid synthesis and attachment in yeast mitochondria." J Biol Chem 284:23234-23242.19570983