You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameAcetyl-CoA carboxylase, mitochondrial
Synonyms
  • ACC
  • Biotin carboxylase
Gene NameHFA1
Enzyme Class
Biological Properties
General FunctionInvolved in acetyl-CoA carboxylase activity
Specific FunctionCatalyzes the rate-limiting reaction in the mitochondrial fatty acid synthesis (FAS) type II pathway. Responsible for the production of the mitochondrial malonyl-CoA, used for the biosynthesis of the cofactor lipoic acid. This protein carries three functions:biotin carboxyl carrier protein, biotin carboxylase, and carboxyltransferase
Cellular LocationMitochondrion
SMPDB Pathways
Fatty acid biosynthesisPW002458 ThumbThumb?image type=greyscaleThumb?image type=simple
Pyruvate metabolismPW002447 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Fatty acid biosynthesisec00061 Map00061
Propanoate metabolismec00640 Map00640
Pyruvate metabolismec00620 Map00620
SMPDB ReactionsNot Available
KEGG Reactions
Carbonic acid + Adenosine triphosphate + Acetyl-CoAphosphate + malonyl-CoA + hydron + ADP
Metabolites
YMDB IDNameView
YMDB00109Adenosine triphosphateShow
YMDB00312Acetyl-CoAShow
YMDB00382Carbonic acidShow
YMDB00533malonyl-CoAShow
YMDB00862hydronShow
YMDB00907phosphateShow
YMDB00912Carbon dioxideShow
YMDB00914ADPShow
GO Classification
Component
Not Available
Function
ATP binding
vitamin binding
biotin binding
catalytic activity
ligase activity
ligase activity, forming carbon-carbon bonds
CoA carboxylase activity
binding
acetyl-CoA carboxylase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
Process
organic acid metabolic process
oxoacid metabolic process
carboxylic acid metabolic process
monocarboxylic acid metabolic process
metabolic process
fatty acid metabolic process
fatty acid biosynthetic process
cellular metabolic process
Gene Properties
Chromosome Locationchromosome 13
LocusYMR207C
Gene Sequence>6822 bp AAAGGGAAGACAATTACACACGGCCAAAGCTGGGGGGCTCGCCGGATACATTCTCACTTT TACATTACCATATTCACAATTACTTGCATTCGAATAGGACAGTACAAGCTCGCGTTATAT TTGGATCCTTATCGATTCTATAATATAACGGGCAGCCAGATAGTACGGTTGAAAGGACAG CGCCCTGAATACAGAAAACGCATTTTTGCCCATTCGTATAGGCATTCATCTCGAATAGGT TTGAATTTTCCATCTAGAAGAAGGTATTCCAATTATGTGGATCGAGGCAATATTCATAAA CATACTCGATTACCGCCCCAGTTCATAGGGCTAAATACTGTGGAAAGTGCCCAACCTTCA ATATTAAGAGATTTTGTTGATTTACGTGGTGGACATACTGTTATTTCAAAGATCTTAATA GCAAACAATGGTATTGCTGCGGTGAAAGAAATGAGATCTATAAGAAAATGGGCGTACGAG ACGTTCAATGATGAAAAAATCATTCAATTCGTGGTAATGGCGACACCTGATGATTTACAC GCAAATTCGGAGTATATTAGAATGGCAGACCAATATGTGCAGGTACCAGGGGGTACCAAC AACAACAATTACGCCAACATAGACTTAATACTGGACGTGGCAGAGCAAACGGATGTGGAT GCGGTCTGGGCTGGATGGGGCCATGCTTCTGAAAATCCGTGTCTTCCTGAGCTGTTAGCT AGTTCACAAAGGAAAATACTATTCATTGGTCCTCCTGGGCGCGCTATGAGATCATTGGGT GACAAGATTTCTTCCACTATTGTAGCACAAAGCGCTAAAATCCCGTGTATCCCTTGGTCT GGTTCACATATAGACACTATCCATATCGATAACAAGACGAACTTTGTATCTGTGCCGGAT GATGTATATGTAAGGGGATGTTGTTCCTCACCTGAAGATGCTTTAGAAAAGGCTAAATTA ATAGGATTTCCTGTAATGATTAAGGCATCCGAAGGTGGTGGAGGTAAGGGCATTAGGCGA GTAGATAATGAGGATGATTTTATTGCATTATATCGCCAAGCAGTGAATGAGACACCTGGG TCGCCTATGTTTGTTATGAAAGTTGTCACTGATGCTCGTCACTTAGAGGTACAGTTATTA GCTGACCAATATGGCACTAACATTACATTGTTTGGGAGAGACTGTTCCATACAAAGGCGG CACCAAAAGATTATAGAAGAGGCACCAGTGACAATAACCAAGCCTGAAACGTTTCAAAGG ATGGAACGCGCAGCAATTCGTCTAGGTGAATTGGTAGGTTATGTTTCTGCGGGCACTGTC GAATACTTATATTCACCAAAAGATGATAAATTTTACTTTTTAGAACTGAATCCGAGACTA CAAGTAGAGCATCCAACGACAGAAATGATATCTGGCGTAAACCTTCCTGCCACTCAACTG CAAATCGCCATGGGCATTCCTATGCACATGATAAGTGATATCAGAAAACTTTATGGTTTA GATCCAACGGGAACTTCGTATATTGATTTTAAAAATTTAAAGAGACCCTCGCCAAAAGGC CATTGTATTTCATGCAGGATCACTTCAGAAGATCCTAATGAAGGTTTCAAGCCCTCCACT GGGAAAATACATGAGCTCAATTTTCGTTCTTCTTCCAATGTTTGGGGTTACTTCTCAGTA GGAAATAATGGTGCTATTCACTCATTTTCAGATTCCCAATTTGGGCACATTTTTGCTGTA GGAAACGATAGGCAAGATGCAAAGCAAAACATGGTTTTAGCTCTAAAAGATTTTTCCATC CGAGGAGAATTCAAAACCCCCATAGAGTACCTGATAGAGCTATTAGAAACTCGGGACTTT GAGAGTAATAACATATCGACTGGTTGGTTAGATGATTTGATTTTGAAAAATTTATCTTCC GATAGCAAACTAGATCCAACGCTCGCTATTATCTGTGGTGCCGCAATGAAAGCATACGTT TTCACAGAAAAGGTGAGGAATAAGTATTTGGAATTATTGCGGAGGGGCCAAGTTCCACCT AAAGATTTTCTTAAAACGAAGTTTCCTGTTGACTTCATTTTCGATAATAATAGATACTTG TTCAATGTTGCTCAATCATCTGAAGAACAATTTATTCTTTCTATCAATAAGTCTCAATGT GAAGTTAATGTTCAAAAATTGTCCAGTGACTGCTTGTTGATCTCCGTTGACGGTAAATGC CATACAGTTTATTGGAAGGACGATATCAGAGGTACAAGACTTTCGATAGACTCCAATACC ATATTTTTAGAAGCTGAACTCAATCCCACTCAAGTGATCTCTCCAACTCCGGGGAAATTG GTGAAATATTTGGTCCGAAGTGGTGATCACGTTTTTGCTGGACAGCAATATGCAGAAATA GAAATAATGAAAATGCAGATGCCACTAGTAGCGAAAAGTGATGGTGTAATTGAGTTACTA AGACAGCCCGGTTCCATAATTGAGGCTGGTGATGTCATCGCAAAATTGACTTTGGATTCG CCGTCCAAAGCTAACGAATCGTCTTTATACCGCGGAGAATTACCTGTTTTAGGTCCACCG CTAATAGAGGGTAGCCGACCAAACCATAAGCTCAGAGTCTTAATAAATAGGTTAGAAAAT ATTCTCAATGGATATCATGAAAACTCTGGAATAGAAACTACTCTAAAAGAGTTGATAAAA ATATTGAGAGATGGTAGGCTTCCTTATTCAGAATGGGATTCCCAAATTTCTACGGTACGC AATAGACTACCAAGGCAATTGAATGAGGGGCTGGGAAATCTAGTCAAGAAATCTGTTTCT TTTCCTGCAAAGGAACTGCACAAATTAATGAAGCGCTACTTGGAAGAAAATACAAATGAT CATGTAGTTTATGTTGCCTTACAGCCACTTCTTAAAATTAGTGAAAGGTATAGCGAAGGT TTAGCTAATCACGAATGTGAAATTTTTTTAAAGTTGATTAAAAAGTACTATGCTGTTGAG AAAATTTTTGAAAATCATGATATACATGAAGAAAGAAACTTACTAAATCTGCGGAGGAAA GACCTTACAAACTTAAAAGAAATTTTGTGCATAAGTTTATCGCATGCTAACGTAGTCGCA AAGAACAAGTTAGTAACTGCAATATTGCATGAATACGAGCCATTGTGCCAGGATTCCTCT AAGATGTCTTTAAAATTCAGGGCTGTTATACATGATTTGGCAAGTTTGGAATCTAAGTGG GCTAAAGAGGTTGCTGTAAAGGCAAGATCAGTGCTACTCAGAGGGATTTTCCCTCCCATA AAGAAAAGAAAAGAGCATATTAAAACTCTCCTGCAATTGCACATAAAGGATACTGGTGCC GAAAACATTCACAGCAGGAACATATATTCCTGTATGAGGGATTTTGGTAATTTAATACAT TCAAATCTGATACAACTTCAGGATTTGTTCTTTTTTTTTGGCCATCAAGATACGGCTCTT TCCAGTATAGCATCTGAAATTTATGCAAGGTATGCCTACGGCAATTATCAATTAAAAAGT ATTAAGATTCATAAAGGAGCGCCTGATTTACTAATGTCATGGCAATTCAGCTCATTAAGA AATTATTTAGTCAATTCTGATGGTGAGAGTGATGAGTTTACAAAACTTTCTAAACCTCCC TCAACATCAGGTAAGAGCTCAGCAAATAGTTTTGGTCTTCTTGTCAACATGCGTGCGCTT GAATCTCTGGAAAAGACATTAGACGAGGTATACGAACAAATTCATATTCCTGAGGAAAGA CTTTCCAGCGGAGAGAACTCTCTTATTGTTAATATTTTATCTCCTATTCGTTACAGAAGT GAAAATGATCTAATTAAAACTTTAAAAATTAAACTTCATGAAAATGAGAGAGGTCTATCC AAGCTCAAGGTTAATCGTATTACATTTGCATTTATCGCCGCGAATGCGCCCGCTGTTAAA TTTTACTCCTTTGATGGAACTACGTACGATGAAATCTCTCAAATAAGAAATATGGATCCA TCCTATGAAGCACCGTTAGAGTTAGGAAAAATGTCGAACTATAAAATCAGATCACTACCT ACATACGATAGTAGTATACGCATTTTTGAAGGTATTAGCAAATTTACGCCGCTAGATAAA AGGTTCTTTGTCAGGAAAATCATAAATTCCTTCATGTATAATGATCAAAAAACAACCGAA GAAAACTTGAAAGCGGAAATCAATGCTCAAGTGGTTTATATGTTAGAACATCTAGGAGCA GTTGACATCTCAAATTCAGACTTGAATCATATTTTTTTAAGTTTCAATACAGTTCTTAAC ATACCAGTACATCGTCTCGAGGAAATTGTGAGTACAATTCTAAAGACTCACGAAACCAGA TTGTTTCAAGAAAGAATCACAGATGTAGAAATTTGCATCTCTGTTGAGTGCCTAGAAACA AAGAAGCCAGCCCCGCTTAGATTACTTATTTCTAATAAATCTGGGTATGTGGTAAAAATT GAGACATATTACGAAAAGATAGGGAAAAATGGGAATCTGATTTTGGAACCGTGTAGTGAG CAGAGCCATTATAGCCAGAAATCTCTCTCTCTTCCTTACTCGGTCAAGGATTGGCTACAA CCTAAAAGGTACAAAGCTCAATTCATGGGTACAACATATGTGTACGATTTCCCAGGTCTG TTTCATCAAGCTGCAATCCAACAGTGGAAAAGGTATTTTCCAAAACATAAGCTGAATGAC AGTTTTTTTAGTTGGGTTGAATTGATAGAACAAAACGGTAATTTAATAAAAGTAAACAGG GAGCCAGGCCTTAATAATATAGGGATGGTTGCTTTTGAGATTATGGTTCAGACACCTGAA TATCCTGAAGGGCGTAACATGATCGTGATTTCTAATGATATTACCTACAATATTGGATCT TTTGGACCGAGAGAAGATTTGTTTTTTGATAGGGTCACAAATTATGCAAGAGAGAGAGGG ATCCCGAGGATATACTTGGCGGCGAATTCAGGAGCTAAATTGGGTATAGCCGAAGAGCTG ATCCCTCTATTTCGTGTAGCATGGAATGACCCCTCTGATCCAACAAAGGGTTTCCAGTAC TTATACTTAGCTCCAAAAGACATGCAGCTACTGAAAGATTCTGGGAAAGGAAATTCGGTT GTTGTTGAACACAAGATGGTATACGGTGAAGAGAGATATATTATTAAAGCAATAGTCGGA TTCGAAGAGGGTTTAGGTGTTGAATGTTTACAGGGCTCGGGTTTAATTGCTGGTGCCACT TCGAAAGCGTATAGAGACATTTTCACTATTACTGCTGTTACTTGTCGGTCCGTTGGTATA GGTTCCTATCTGGTCAGACTAGGACAACGTACTATTCAGGTGGAGGATAAGCCTATCATA CTGACGGGTGCATCGGCGATTAATAAAGTTTTGGGTACCGATATCTATACATCTAACCTA CAAATTGGCGGAACCCAAATCATGTATAAAAACGGAATAGCGCATTTAACAGCCAGTAAT GATATGAAAGCCATCGAAAAAATAATGACATGGTTATCATATGTCCCGGCGAAAAGAGAT ATGAGTCCTCCACTTCTTGAAACTATGGATAGATGGGATAGGGATGTAGACTTCAAACCT GCCAAGCAAGTGCCATATGAGGCAAGGTGGTTGATAGAGGGTAAATGGGACTCAAATAAC AACTTCCAGTCAGGCCTATTTGATAAGGATTCGTTTTTTGAGACATTATCTGGATGGGCC AAAGGTGTAATAGTTGGAAGAGCACGTCTTGGAGGTATTCCCGTGGGTGTTATTGCGGTA GAAACTAAGACTATCGAAGAAATAATCCCCGCTGACCCAGCTAATCTGGATTCTTCAGAG TTTTCCGTTAAAGAAGCAGGACAGGTGTGGTATCCAAATTCCGCGTTCAAAACAGCTCAA ACTATAAATGATTTTAACTATGGTGAGCAATTACCATTGATTATCTTAGCCAATTGGAGG GGATTTTCTGGCGGTCAAAGGGATATGTACAATGAAGTACTAAAGTACGGGTCTTTTATT GTTGACGCTCTGGTTGACTACAAACAACCCATACTGATATACATTCCGCCCTTTGGTGAA TTAAGGGGCGGATCATGGGTTGTTATAGATCCAACTATTAATCCTGAACAAATGGAAATG TATGCCGATGTTGAATCTAGGGGAGGTGTGTTAGAACCTGACGGAGTAGTTAGCATAAAA TACCGTAAGGAGAAAATGATAGAGACGATGATTCGATTAGACTCCACATATGGACATTTG AGAAGAACGTTGACAGAAAAAAAGTTATCTTTGGAAAAACAAAATGATCTTACGAAGAGA TTGAAAATAAGAGAGAGACAGTTGATACCAATTTACAATCAAATCAGCATACAGTTTGCA GATTTACATGATAGATCGACTAGGATGCTAGTTAAAGGAGTAATCCGAAATGAGTTGGAA TGGAAAAAGTCACGCAGATTTTTATATTGGAGACTGAGAAGGAGGTTGAACGAGGGACAA GTGATCAAAAGACTGCAAAAAAAAACATGTGATAACAAAACGAAAATGAAGTACGACGAC CTGTTGAAAATAGTTCAGTCATGGTATAACGATCTGGATGTTAATGATGACAGAGCAGTA GTGGAGTTCATAGAAAGAAATTCGAAAAAAATTGACAAGAACATTGAAGAGTTTGAGATC TCGCTGTTGATCGATGAGCTTAAGAAAAAATTTGAAGACAGAAGGGGAAACATTGTCCTT GAAGAGCTAACTAGGTTGGTGGACAGTAAGCGAAAGAGATAG
Protein Properties
Pfam Domain Function
Protein Residues2273
Protein Molecular Weight259161.0
Protein Theoretical pI8.95
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Acetyl-CoA carboxylase, mitochondrial KGKTITHGQSWGARRIHSHFYITIFTITCIRIGQYKLALYLDPYRFYNITGSQIVRLKGQ RPEYRKRIFAHSYRHSSRIGLNFPSRRRYSNYVDRGNIHKHTRLPPQFIGLNTVESAQPS ILRDFVDLRGGHTVISKILIANNGIAAVKEMRSIRKWAYETFNDEKIIQFVVMATPDDLH ANSEYIRMADQYVQVPGGTNNNNYANIDLILDVAEQTDVDAVWAGWGHASENPCLPELLA SSQRKILFIGPPGRAMRSLGDKISSTIVAQSAKIPCIPWSGSHIDTIHIDNKTNFVSVPD DVYVRGCCSSPEDALEKAKLIGFPVMIKASEGGGGKGIRRVDNEDDFIALYRQAVNETPG SPMFVMKVVTDARHLEVQLLADQYGTNITLFGRDCSIQRRHQKIIEEAPVTITKPETFQR MERAAIRLGELVGYVSAGTVEYLYSPKDDKFYFLELNPRLQVEHPTTEMISGVNLPATQL QIAMGIPMHMISDIRKLYGLDPTGTSYIDFKNLKRPSPKGHCISCRITSEDPNEGFKPST GKIHELNFRSSSNVWGYFSVGNNGAIHSFSDSQFGHIFAVGNDRQDAKQNMVLALKDFSI RGEFKTPIEYLIELLETRDFESNNISTGWLDDLILKNLSSDSKLDPTLAIICGAAMKAYV FTEKVRNKYLELLRRGQVPPKDFLKTKFPVDFIFDNNRYLFNVAQSSEEQFILSINKSQC EVNVQKLSSDCLLISVDGKCHTVYWKDDIRGTRLSIDSNTIFLEAELNPTQVISPTPGKL VKYLVRSGDHVFAGQQYAEIEIMKMQMPLVAKSDGVIELLRQPGSIIEAGDVIAKLTLDS PSKANESSLYRGELPVLGPPLIEGSRPNHKLRVLINRLENILNGYHENSGIETTLKELIK ILRDGRLPYSEWDSQISTVRNRLPRQLNEGLGNLVKKSVSFPAKELHKLMKRYLEENTND HVVYVALQPLLKISERYSEGLANHECEIFLKLIKKYYAVEKIFENHDIHEERNLLNLRRK DLTNLKKILCISLSHANVVAKNKLVTAILHEYEPLCQDSSKMSLKFRAVIHDLASLESKW AKEVAVKARSVLLRGIFPPIKKRKEHIKTLLQLHIKDTGAENIHSRNIYSCMRDFGNLIH SNLIQLQDLFFFFGHQDTALSSIASEIYARYAYGNYQLKSIKIHKGAPDLLMSWQFSSLR NYLVNSDGESDEFTKLSKPPSTSGKSSANSFGLLVNMRALESLEKTLDEVYEQIHIPEER LSSGENSLIVNILSPIRYRSENDLIKTLKIKLHENERGLSKLKVNRITFAFIAANAPAVK FYSFDGTTYDEISQIRNMDPSYEAPLELGKMSNYKIRSLPTYDSSIRIFEGISKFTPLDK RFFVRKIINSFMYNDQKTTEENLKAEINAQVVYMLEHLGAVDISNSDLNHIFLSFNTVLN IPVHRLEEIVSTILKTHETRLFQERITDVEICISVECLETKKPAPLRLLISNKSGYVVKI ETYYEKIGKNGNLILEPCSEQSHYSQKSLSLPYSVKDWLQPKRYKAQFMGTTYVYDFPGL FHQAAIQQWKRYFPKHKLNDSFFSWVELIEQNGNLIKVNREPGLNNIGMVAFEIMVQTPE YPEGRNMIVISNDITYNIGSFGPREDLFFDRVTNYARERGIPRIYLAANSGAKLGIAEEL IPLFRVAWNDPSDPTKGFQYLYLAPKDMQLLKDSGKGNSVVVEHKMVYGEERYIIKAIVG FEEGLGVECLQGSGLIAGATSKAYRDIFTITAVTCRSVGIGSYLVRLGQRTIQVEDKPII LTGASAINKVLGTDIYTSNLQIGGTQIMYKNGIAHLTASNDMKAIEKIMTWLSYVPAKRD MSPPLLETMDRWDRDVDFKPAKQVPYEARWLIEGKWDSNNNFQSGLFDKDSFFETLSGWA KGVIVGRARLGGIPVGVIAVETKTIEEIIPADPANLDSSEFSVKEAGQVWYPNSAFKTAQ TINDFNYGEQLPLIILANWRGFSGGQRDMYNEVLKYGSFIVDALVDYKQPILIYIPPFGE LRGGSWVVIDPTINPEQMEMYADVESRGGVLEPDGVVSIKYRKEKMIETMIRLDSTYGHL RRTLTEKKLSLEKQNDLTKRLKIRERQLIPIYNQISIQFADLHDRSTRMLVKGVIRNELE WKKSRRFLYWRLRRRLNEGQVIKRLQKKTCDNKTKMKYDDLLKIVQSWYNDLDVNDDRAV VEFIERNSKKIDKNIEEFEISLLIDELKKKFEDRRGNIVLEELTRLVDSKRKR
References
External Links
ResourceLink
Saccharomyces Genome Database HFA1
Uniprot IDP32874
Uniprot NameHFA1_YEAST
GenBank Gene IDD78165
Genebank Protein ID2804173
General Reference
  • Bowman, S., Churcher, C., Badcock, K., Brown, D., Chillingworth, T., Connor, R., Dedman, K., Devlin, K., Gentles, S., Hamlin, N., Hunt, S., Jagels, K., Lye, G., Moule, S., Odell, C., Pearson, D., Rajandream, M., Rice, P., Skelton, J., Walsh, S., Whitehead, S., Barrell, B. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XIII." Nature 387:90-93.9169872
  • Kearsey, S. E. (1993). "Identification of a Saccharomyces cerevisiae gene closely related to FAS3 (acetyl-CoA carboxylase)" DNA Seq 4:69-70.7906156
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Sickmann, A., Reinders, J., Wagner, Y., Joppich, C., Zahedi, R., Meyer, H. E., Schonfisch, B., Perschil, I., Chacinska, A., Guiard, B., Rehling, P., Pfanner, N., Meisinger, C. (2003). "The proteome of Saccharomyces cerevisiae mitochondria." Proc Natl Acad Sci U S A 100:13207-13212.14576278
  • Hoja, U., Marthol, S., Hofmann, J., Stegner, S., Schulz, R., Meier, S., Greiner, E., Schweizer, E. (2004). "HFA1 encoding an organelle-specific acetyl-CoA carboxylase controls mitochondrial fatty acid synthesis in Saccharomyces cerevisiae." J Biol Chem 279:21779-21786.14761959