Canmetcon
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameUTP--glucose-1-phosphate uridylyltransferase
Synonyms
  • UDP-glucose pyrophosphorylase
  • UDPGP
  • UGPase
Gene NameUGP1
Enzyme Class
Biological Properties
General FunctionInvolved in nucleotidyltransferase activity
Specific FunctionPlays a central role as a glucosyl donor in cellular metabolic pathways
Cellular LocationNot Available
SMPDB Pathways
Amino sugar and nucleotide sugar metabolismPW002413 ThumbThumb?image type=greyscaleThumb?image type=simple
Starch and sucrose metabolismPW002481 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Amino sugar and nucleotide sugar metabolismec00520 Map00520
Galactose metabolismec00052 Map00052
Pentose and glucuronate interconversionsec00040 Map00040
Starch and sucrose metabolismec00500 Map00500
SMPDB Reactions
Glucose 1-phosphate + Uridine triphosphate + hydronUridine diphosphate glucose + Uridine 5'-diphosphate
KEGG Reactions
Uridine triphosphate + Glucose 1-phosphate + hydronPyrophosphate + Uridine diphosphate glucose
Metabolites
YMDB IDNameView
YMDB00212Uridine diphosphate glucoseShow
YMDB00219PyrophosphateShow
YMDB00288Glucose 1-phosphateShow
YMDB00307Uridine 5'-diphosphateShow
YMDB00326Uridine triphosphateShow
YMDB00415UDP-D-glucoseShow
YMDB00862hydronShow
YMDB00970alpha-D-glucose 1-phosphateShow
GO Classification
Component
Not Available
Function
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
nucleotidyltransferase activity
Process
metabolic process
Gene Properties
Chromosome Locationchromosome 11
LocusYKL035W
Gene Sequence>1500 bp ATGTCCACTAAGAAGCACACCAAAACACATTCCACTTATGCATTCGAGAGCAACACAAAC AGCGTTGCTGCCTCACAAATGAGAAACGCCTTAAACAAGTTGGCGGACTCTAGTAAACTT GACGATGCTGCTCGCGCTAAGTTTGAGAACGAACTGGATTCGTTTTTCACGCTTTTCAGG AGATATTTGGTAGAGAAGTCTTCTAGAACCACCTTGGAATGGGACAAGATCAAGTCTCCC AACCCGGATGAAGTGGTTAAGTATGAAATTATTTCTCAGCAGCCCGAGAATGTCTCAAAC CTTTCCAAATTGGCTGTTTTGAAGTTGAACGGTGGGCTGGGTACCTCCATGGGCTGCGTT GGCCCTAAATCTGTTATTGAAGTGAGAGAGGGAAACACCTTTTTGGATTTGTCTGTTCGT CAAATTGAATACTTGAACAGACAGTACGATAGCGACGTGCCATTGTTATTGATGAATTCT TTCAACACTGACAAGGATACGGAACACTTGATTAAGAAGTATTCCGCTAACAGAATCAGA ATCAGATCTTTCAATCAATCCAGGTTCCCAAGAGTCTACAAGGATTCTTTATTGCCTGTC CCCACCGAATACGATTCTCCACTGGATGCTTGGTATCCACCAGGTCACGGTGATTTGTTT GAATCTTTACACGTATCTGGTGAACTGGATGCCTTAATTGCCCAAGGAAGAGAAATATTA TTTGTTTCTAACGGTGACAACTTGGGTGCTACCGTCGACTTAAAAATTTTAAACCACATG ATCGAGACTGGTGCCGAATATATAATGGAATTGACTGATAAGACCAGAGCCGATGTTAAA GGTGGTACTTTGATTTCTTACGATGGTCAAGTCCGTTTATTGGAAGTCGCCCAAGTTCCA AAAGAACACATTGACGAATTCAAAAATATCAGAAAGTTTACCAACTTCAACACGAATAAC TTATGGATCAATCTGAAAGCAGTAAAGAGGTTGATCGAATCGAGCAATTTGGAGATGGAA ATCATTCCAAACCAAAAAACTATAACAAGAGACGGTCATGAAATTAATGTCTTACAATTA GAAACCGCTTGTGGTGCTGCTATCAGGCATTTTGATGGTGCTCACGGTGTTGTCGTTCCA AGATCAAGATTCTTGCCTGTCAAGACCTGTTCCGATTTGTTGCTGGTTAAATCAGATCTA TTCCGTCTGGAACACGGTTCTTTGAAGTTAGACCCATCCCGTTTTGGTCCAAACCCATTA ATCAAGTTGGGCTCGCATTTCAAAAAGGTTTCTGGTTTTAACGCAAGAATCCCTCACATC CCAAAAATCGTCGAGCTAGATCATTTGACCATCACTGGTAACGTCTTTTTAGGTAAAGAT GTCACTTTGAGGGGTACTGTCATCATCGTTTGCTCCGACGGTCATAAAATCGATATTCCA AACGGCTCCATATTGGAAAATGTTGTCGTTACTGGTAATTTGCAAATCTTGGAACATTGA
Protein Properties
Pfam Domain Function
Protein Residues499
Protein Molecular Weight55987.39844
Protein Theoretical pI7.5
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>UTP--glucose-1-phosphate uridylyltransferase MSTKKHTKTHSTYAFESNTNSVAASQMRNALNKLADSSKLDDAARAKFENELDSFFTLFR RYLVEKSSRTTLEWDKIKSPNPDEVVKYEIISQQPENVSNLSKLAVLKLNGGLGTSMGCV GPKSVIEVREGNTFLDLSVRQIEYLNRQYDSDVPLLLMNSFNTDKDTEHLIKKYSANRIR IRSFNQSRFPRVYKDSLLPVPTEYDSPLDAWYPPGHGDLFESLHVSGELDALIAQGREIL FVSNGDNLGATVDLKILNHMIETGAEYIMELTDKTRADVKGGTLISYDGQVRLLEVAQVP KEHIDEFKNIRKFTNFNTNNLWINLKAVKRLIESSNLEMEIIPNQKTITRDGHEINVLQL ETACGAAIRHFDGAHGVVVPRSRFLPVKTCSDLLLVKSDLFRLEHGSLKLDPSRFGPNPL IKLGSHFKKVSGFNARIPHIPKIVELDHLTITGNVFLGKDVTLRGTVIIVCSDGHKIDIP NGSILENVVVTGNLQILEH
References
External Links
ResourceLink
Saccharomyces Genome Database UGP1
Uniprot IDP32861
Uniprot NameUGPA1_YEAST
GenBank Gene IDX69584
Genebank Protein ID4794
General Reference
  • Purnelle, B., Skala, J., Van Dyck, L., Goffeau, A. (1992). "The sequence of a 12 kb fragment on the left arm of yeast chromosome XI reveals five new open reading frames, including a zinc finger protein and a homolog of the UDP-glucose pyrophosphorylase from potato." Yeast 8:977-986.1481573
  • Dujon, B., Alexandraki, D., Andre, B., Ansorge, W., Baladron, V., Ballesta, J. P., Banrevi, A., Bolle, P. A., Bolotin-Fukuhara, M., Bossier, P., et, a. l. .. (1994). "Complete DNA sequence of yeast chromosome XI." Nature 369:371-378.8196765
  • Daran, J. M., Dallies, N., Thines-Sempoux, D., Paquet, V., Francois, J. (1995). "Genetic and biochemical characterization of the UGP1 gene encoding the UDP-glucose pyrophosphorylase from Saccharomyces cerevisiae." Eur J Biochem 233:520-530.7588797
  • Ficarro, S. B., McCleland, M. L., Stukenberg, P. T., Burke, D. J., Ross, M. M., Shabanowitz, J., Hunt, D. F., White, F. M. (2002). "Phosphoproteome analysis by mass spectrometry and its application to Saccharomyces cerevisiae." Nat Biotechnol 20:301-305.11875433
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Gruhler, A., Olsen, J. V., Mohammed, S., Mortensen, P., Faergeman, N. J., Mann, M., Jensen, O. N. (2005). "Quantitative phosphoproteomics applied to the yeast pheromone signaling pathway." Mol Cell Proteomics 4:310-327.15665377
  • Chi, A., Huttenhower, C., Geer, L. Y., Coon, J. J., Syka, J. E., Bai, D. L., Shabanowitz, J., Burke, D. J., Troyanskaya, O. G., Hunt, D. F. (2007). "Analysis of phosphorylation sites on proteins from Saccharomyces cerevisiae by electron transfer dissociation (ETD) mass spectrometry." Proc Natl Acad Sci U S A 104:2193-2198.17287358
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956
  • Roeben, A., Plitzko, J. M., Korner, R., Bottcher, U. M., Siegers, K., Hayer-Hartl, M., Bracher, A. (2006). "Structural basis for subunit assembly in UDP-glucose pyrophosphorylase from Saccharomyces cerevisiae." J Mol Biol 364:551-560.17010990