You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameGABA-specific permease
Synonyms
  • GABA-specific transport protein
Gene NameUGA4
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in transport
Specific FunctionRequired for high-affinity, high-specificity GABA transport. Also transports putrescine
Cellular LocationVacuole membrane; Multi-pass membrane protein
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB000835-Aminolevulinic acidShow
YMDB00335gamma-Aminobutyric acidShow
YMDB00862hydronShow
GO Classification
Component
integral to membrane
cell part
membrane
membrane part
intrinsic to membrane
Function
transporter activity
transmembrane transporter activity
active transmembrane transporter activity
amine transmembrane transporter activity
amino acid transmembrane transporter activity
Process
amine transport
amino acid transport
transmembrane transport
establishment of localization
transport
Gene Properties
Chromosome Locationchromosome 4
LocusYDL210W
Gene Sequence>1716 bp ATGAGTATGTCAAGCAAAAACGAGAATAAGATATCAGTAGAACAAAGAATATCCACTGAT ATCGGTCAGGCTTACCAGTTACAAGGCCTTGGGTCTAACCTAAGGTCGATTCGCTCCAAG ACTGGTGCCGGTGAAGTGAACTATATCGATGCTGCTAAATCTGTAAATGATAACCAACTG CTTGCAGAGATCGGTTATAAACAAGAATTAAAAAGACAATTTTCAACATTACAAGTTTTC GGTATTGCGTTCTCCATTATGGGTCTATTGCCCTCCATTGCATCTGTGATGGGTGGTGGG CTCGGTGGTGGTCCAGCAACATTAGTGTGGGGTTGGTTCGTTGCTGCGTTTTTCATTTTA CTGGTGGGTATTACCATGGCTGAACATGCAAGTTCCATTCCTACCGCTGGTGGTTTGTAC TACTGGACGTATTACTATGCTCCAGAAGGTTATAAAGAGATTATTTCTTTTATTATTGGT TGCTCAAACTCCCTAGCGTTGGCAGCCGGTGTGTGTTCCATTGATTACGGTTTGGCTGAG GAAATTGCTGCTGCTGTCACATTAACCAAAGATGGAAATTTTGAAGTAACGAGTGGGAAA CTTTACGGTATATTTGCTGGAGCAGTGGTGGTTATGTGTATTTGTACATGTGTTGCTTCT GGGGCCATTGCTCGTCTGCAGACGCTAAGTATATTTGCCAATCTTTTCATTATTGTTTTA TTGTTCATTGCGCTACCGATTGGTACCAAGCATAGAATGGGAGGTTTCAATGATGGTGAC TTTATATTTGGGAAATATGAAAACTTAAGTGACTGGAATAATGGTTGGCAATTTTGTCTT GCTGGTTTCATGCCTGCTGTCTGGACTATTGGTTCCTTTGATTCATGTGTCCATCAATCT GAAGAAGCCAAAGATGCCAAGAAATCAGTCCCCATTGGTATAATCTCATCTATTGCTGTT TGTTGGATTTTAGGTTGGTTGATTATTATTTGTTTAATGGCCTGTATCAACCCTGATATT GACAGCGTTTTGGACTCCAAGTACGGCTTTGCTTTGGCTCAAATAATTTATGATTCGTTA GGAAAAAAATGGGCCATTGCATTTATGTCATTGATCGCATTCTGTCAATTTCTAATGGGT GCTTCCATTACCACAGCTGTTTCTAGACAAGTTTGGGCATTTTCCCGTGATAACGGTTTG CCCCTATCAAAGTATATTAAAAGAGTGGATTCTAAATACTCGGTCCCTTTTTTCGCTATT TTGGCTGCCTGTGTAGGTTCCTTGATTTTAGGATTGTTATGTTTGATTGATGATGCCGCC ACTGATGCATTATTTAGTCTGGCTGTTGCAGGAAACAATTTGGCATGGAGTACCCCTACA GTTTTCCGTTTAACATCAGGTAGAGATTTATTTAGACCTGGTCCATTTTATTTGGGTAAA ATCTGGTCTCCAATTGTTGCTTGGACAGGTGTTGCTTTCCAATTGTTCATTATTATTTTG GTTATGTTCCCCTCTCAACAACATGGTATTACTAAATCCACAATGAATTATGCATGCGTT ATTGGTCCCGGTATCTGGATCCTTGCAGGTATCTACTACAAAGTTTACAAGAAGAAATAC TACCACGGTCCAGCAACCAATTTGTCGGATGATGATTATACTGAAGCCGTTGGTGCTGAT GTTATCGACACAATTATGTCCAAACAGGAACCATAA
Protein Properties
Pfam Domain Function
Protein Residues571
Protein Molecular Weight61872.30078
Protein Theoretical pI6.64
Signalling Regions
  • None
Transmembrane Regions
  • 74-94
  • 106-126
  • 154-174
  • 199-219
  • 229-249
  • 272-292
  • 313-333
  • 365-385
  • 417-437
  • 442-462
  • 483-503
  • 515-535
Protein Sequence>GABA-specific permease MSMSSKNENKISVEQRISTDIGQAYQLQGLGSNLRSIRSKTGAGEVNYIDAAKSVNDNQL LAEIGYKQELKRQFSTLQVFGIAFSIMGLLPSIASVMGGGLGGGPATLVWGWFVAAFFIL LVGITMAEHASSIPTAGGLYYWTYYYAPEGYKEIISFIIGCSNSLALAAGVCSIDYGLAE EIAAAVTLTKDGNFEVTSGKLYGIFAGAVVVMCICTCVASGAIARLQTLSIFANLFIIVL LFIALPIGTKHRMGGFNDGDFIFGKYENLSDWNNGWQFCLAGFMPAVWTIGSFDSCVHQS EEAKDAKKSVPIGIISSIAVCWILGWLIIICLMACINPDIDSVLDSKYGFALAQIIYDSL GKKWAIAFMSLIAFCQFLMGASITTAVSRQVWAFSRDNGLPLSKYIKRVDSKYSVPFFAI LAACVGSLILGLLCLIDDAATDALFSLAVAGNNLAWSTPTVFRLTSGRDLFRPGPFYLGK IWSPIVAWTGVAFQLFIIILVMFPSQQHGITKSTMNYACVIGPGIWILAGIYYKVYKKKY YHGPATNLSDDDYTEAVGADVIDTIMSKQEP
References
External Links
ResourceLink
Saccharomyces Genome Database UGA4
Uniprot IDP32837
Uniprot NameUGA4_YEAST
GenBank Gene IDX66472
Genebank Protein ID4750
General Reference
  • Andre, B., Hein, C., Grenson, M., Jauniaux, J. C. (1993). "Cloning and expression of the UGA4 gene coding for the inducible GABA-specific transport protein of Saccharomyces cerevisiae." Mol Gen Genet 237:17-25.8455553
  • Jacq, C., Alt-Morbe, J., Andre, B., Arnold, W., Bahr, A., Ballesta, J. P., Bargues, M., Baron, L., Becker, A., Biteau, N., Blocker, H., Blugeon, C., Boskovic, J., Brandt, P., Bruckner, M., Buitrago, M. J., Coster, F., Delaveau, T., del Rey, F., Dujon, B., Eide, L. G., Garcia-Cantalejo, J. M., Goffeau, A., Gomez-Peris, A., Zaccaria, P., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV." Nature 387:75-78.9169867
  • Uemura, T., Tomonari, Y., Kashiwagi, K., Igarashi, K. (2004). "Uptake of GABA and putrescine by UGA4 on the vacuolar membrane in Saccharomyces cerevisiae." Biochem Biophys Res Commun 315:1082-1087.14985124
  • Kim, H., Melen, K., Osterberg, M., von Heijne, G. (2006). "A global topology map of the Saccharomyces cerevisiae membrane proteome." Proc Natl Acad Sci U S A 103:11142-11147.16847258