You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameCarnitine O-acetyltransferase, mitochondrial
Synonyms
  • Carnitine acetylase
Gene NameCAT2
Enzyme Class
Biological Properties
General FunctionInvolved in acyltransferase activity
Specific FunctionCarnitine acetylase is specific for short chain fatty acids. Carnitine acetylase seems to affect the flux through the pyruvate dehydrogenase complex. It may be involved as well in the transport of acetyl-CoA into mitochondria
Cellular LocationPeroxisome. Mitochondrion inner membrane; Peripheral membrane protein; Matrix side
SMPDB Pathways
Fatty acid metabolismPW002460 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Fatty acid metabolismec00071 Map00071
SMPDB Reactions
Palmityl-CoA + (R)-CarnitineHexadecanoylcarnitine + Coenzyme A
KEGG Reactions
(R)-Carnitine + Acetyl-CoAO-acetylcarnitinium + Coenzyme A
Metabolites
YMDB IDNameView
YMDB00045Coenzyme AShow
YMDB00188L-CarnitineShow
YMDB00301Palmityl-CoAShow
YMDB00312Acetyl-CoAShow
YMDB00351L-AcetylcarnitineShow
YMDB00438S-Adenosyl-L-methionineShow
YMDB00616(R)-CarnitineShow
YMDB00617O-acetylcarnitiniumShow
YMDB01534HexadecanoylcarnitineShow
GO Classification
Component
Not Available
Function
acyltransferase activity
catalytic activity
transferase activity
transferase activity, transferring acyl groups
transferase activity, transferring acyl groups other than amino-acyl groups
Process
Not Available
Gene Properties
Chromosome Locationchromosome 13
LocusYML042W
Gene Sequence>2013 bp ATGAGGATCTGTCATTCGAGAACTCTCTCAAACTTAAAGGATCTTCCGATAACGTCAAGG AGAGCAATGCATTCGGCCATTGTCAATTACTCCACCCAAAAGGCCCAATTTCCCGTAGAG ACAAATAATGGGGAACACTATTGGGCGGAAAAGCCGAACAAATTCTACCAGAACAAAAGG CCCAATTTTCAAGGCATTACCTTTGCTAAACAACAAGACTTACCATCATTACCCGTGCCC GAATTGAAGTCTACACTTGACAAGTATTTGCAAACCATCCGCCCATTTTGCAATGATGTA GAAACTTTTGAAAGACAGCAGCTGTTATGTAAGGACTTCTCGGAGCACATGGGGCCTATC TTACAAGACCGATTGAAAGAGTATGCCAACGATAAAAGAAACTGGATGGCCAAGTTTTGG GATGAACAATCCTATTTACAATACAACGATCCTATTGTTCCATACGTCTCTTATTTTTAT TCTCATATGCCATTACCGAATCATTTATCGAAGATCGATAATGATCCTTTGATTAAGGCT ACTGCGATTATCTCAACCGTGGTTAAATTCATCGAAGCTATTAAAGATGAATCTTTACCC GTAGAAATTATCAAAGGTATGCCATTTTGTATGAATAGTTTTTCATTGATGTTTAACACT TCGAGATTGCCTGGTAAGCCAGAGGATAACCAAGATACAAATATTTTTTATTCAGTTTAT GAGAACAACTTTGTAACTATCGCTTATAAAGGGAAGTTTTACAAACTGATGACCCATGAC GGGAATCACAAACCGCTTTCCGAAAACGAAATCTGGAGGCAACTGTACTCTGTGGTATTC CAAGGATCGCAGTCCGATCCCAAACTAGGTGGCATTGGTTCTCTCACCTCTTTACCTCGT GATCAATGGCGTGAAGTACATATGGAGCTTATGAAGGATCCTATTTCTCAGGATTCACTA GAAACAATCCATAAGTCTTCCTTTATGCTATGTTTGGATCTTGACCAATCCCCTGTCACT TTGGAAGAAAAGTCAAGAAATTGCTGGCACGGTGATGGTATTAACAGATTCTACGATAAG TCTTTACAGTTCCTAGTCACCGGTAATGGTTCATCAGGTTTCTTAGCTGAACACTCGAAG ATGGATGGTACGCCAACATTGTTTTTAAATAACTACGTTTGTCAGCAGTTGAATAAACTA GATGTGGATGACTTCATGAGAAAAGTAATTACGCCATCATCTACGGTGGCAATGAAACCT ATGGAACTGCCCTTCATTATCACACCGAAGATTCATAAAGCAATCGAATCTGCCCAACTA CAATTTAAGGAAACAATTGGTGAGCATGACCTACGTGTTTGGCACTACAACAAATATGGA AAAACGTTTATAAAACGCCATGGCATGTCACCTGATGCATTTATTCAACAAGTTATCCAA CTGGCGGTTTTCAAATATCTGAAACGACAACTACCAACTTACGAGGCTGCTTCCACGAGA AAATACTTCAAAGGCCGTACTGAAACTGGTAGATCTGTGTCCACCGCCTCCTTAGAATTT GTTTCTAAATGGCAAAATGGCGATGTTCCTATTGCAGAAAAGATTCAGGCTTTGAAACAT TCTGCAAAAGAGCATTCGACGTACCTGAAAAATGCTGCAAATGGTAATGGTGTCGATCGT CATTTCTTCGGTCTAAAGAATATGCTAAAATCTAATGATGACCAAATTCCGCCCCTTTTC AAAGATCCCTTATTTAATTATTCTTCAACTTGGTTGATCTCCACATCTCAACTATCTTCG GAATATTTTGACGGTTATGGTTGGTCCCAAGTAAATGACAACGGGTTTGGACTGGCATAC ATGTTGAATAACGAGTGGCTGCATATCAATATTGTCAACAAACCAGCCAAGAGTGGAGCC AGTGTTAACAGATTACACTATTATTTATCTCAAGCTGCTGATGAAATTTTTGACGCCTTG GAAAATGAGAATAAACGAAAAGCAAAGTTATGA
Protein Properties
Pfam Domain Function
Protein Residues670
Protein Molecular Weight77241.20313
Protein Theoretical pI8.4
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Carnitine O-acetyltransferase, mitochondrial MRICHSRTLSNLKDLPITSRRAMHSAIVNYSTQKAQFPVETNNGEHYWAEKPNKFYQNKR PNFQGITFAKQQDLPSLPVPELKSTLDKYLQTIRPFCNDVETFERQQLLCKDFSEHMGPI LQDRLKEYANDKRNWMAKFWDEQSYLQYNDPIVPYVSYFYSHMPLPNHLSKIDNDPLIKA TAIISTVVKFIEAIKDESLPVEIIKGMPFCMNSFSLMFNTSRLPGKPEDNQDTNIFYSVY ENNFVTIAYKGKFYKLMTHDGNDKPLSENEIWRQLYSVVFQGSQSDPKLGGIGSLTSLPR DQWREVHLELMKDPISQDSLETIHKSSFMLCLDLDQSPVTLEEKSRNCWHGDGINRFYDK SLQFLVTGNGSSGFLAEHSKMDGTPTLFLNNYVCQQLNKLDVDDFMRKVITPSSTVAMKP MELPFIITPKIHKAIESAQLQFKETIGEHDLRVWHYNKYGKTFIKRHGMSPDAFIQQVIQ LAVFKYLKRQLPTYEAASTRKYFKGRTETGRSVSTASLEFVSKWQNGDVPIAEKIQALKH SAKEHSTYLKNAANGNGVDRHFFGLKNMLKSNDDQIPPLFKDPLFNYSSTWLISTSQLSS EYFDGYGWSQVNDNGFGLAYMLNNEWLHINIVNKPAKSGASVNRLHYYLSQAADEIFDAL ENENKRKAKL
References
External Links
ResourceLink
Saccharomyces Genome Database CAT2
Uniprot IDP32796
Uniprot NameCACP_YEAST
GenBank Gene IDZ14021
Genebank Protein ID3462
General Reference
  • Kispal, G., Sumegi, B., Dietmeier, K., Bock, I., Gajdos, G., Tomcsanyi, T., Sandor, A. (1993). "Cloning and sequencing of a cDNA encoding Saccharomyces cerevisiae carnitine acetyltransferase. Use of the cDNA in gene disruption studies." J Biol Chem 268:1824-1829.8420957
  • Bowman, S., Churcher, C., Badcock, K., Brown, D., Chillingworth, T., Connor, R., Dedman, K., Devlin, K., Gentles, S., Hamlin, N., Hunt, S., Jagels, K., Lye, G., Moule, S., Odell, C., Pearson, D., Rajandream, M., Rice, P., Skelton, J., Walsh, S., Whitehead, S., Barrell, B. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XIII." Nature 387:90-93.9169872
  • Elgersma, Y., van Roermund, C. W., Wanders, R. J., Tabak, H. F. (1995). "Peroxisomal and mitochondrial carnitine acetyltransferases of Saccharomyces cerevisiae are encoded by a single gene." EMBO J 14:3472-3479.7628448
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106