You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameMethionyl-tRNA formyltransferase, mitochondrial
Synonyms
  • MtFMT
Gene NameFMT1
Enzyme Class
Biological Properties
General FunctionInvolved in methionyl-tRNA formyltransferase activity
Specific FunctionFormylates methionyl-tRNA in mitochondria
Cellular LocationMitochondrion
SMPDB PathwaysNot Available
KEGG Pathways
One carbon pool by folateec00670 Map00670
SMPDB ReactionsNot Available
KEGG Reactions
N10-Formyl-THF + Met-tRNA(Met) → 5,6,7,8-Tetrahydrofolic acid + fMet-tRNA(fMet) + hydron
Metabolites
YMDB IDNameView
YMDB00080N10-Formyl-THFShow
YMDB00139Tetrahydrofolic acidShow
YMDB004835,6,7,8-Tetrahydrofolic acidShow
YMDB0051710-Formyltetrahydrofolic acidShow
YMDB00862hydronShow
YMDB00890waterShow
GO Classification
Component
Not Available
Function
transferase activity
transferase activity, transferring one-carbon groups
methyltransferase activity
glycine hydroxymethyltransferase activity
hydroxymethyl-, formyl- and related transferase activity
methionyl-tRNA formyltransferase activity
catalytic activity
Process
metabolic process
biosynthetic process
macromolecule biosynthetic process
cellular macromolecule biosynthetic process
translation
Gene Properties
Chromosome Locationchromosome 2
LocusYBL013W
Gene Sequence>1206 bp ATGGTTAAAATGAGAAGAATAACACCTACACGCCTCCTATTCACATGCAGATATATTTCA AACAATGCTTCTCCACCAGTGCAGCCCTTGAATGTGCTTTTCTTTGGTAGCGACACTTTC AGTAATTTCTCATTGCAAGCACTCAATGAGTTGCGTCAAAATAATGGAAGCTGTGGTATA GTGGACAATATTCAAGTAGTAACTAGGTCGCCGAAGTGGTGCGGTAGACAGAAGTCTATT TTGAAATACCCGCCGATCTTCGATATGGCAGAGAAGCTTCAATTGCCACGCCCAATTACA TGCGACACCAAGCAGGAAATGTTGGCGCTAAGCAAACTGACACCCAGTCGCCAAGGAAAT CCGGAGAACGACGGCTCCGGTGCTCCGTTCAACGCGATCATTGCGGTTTCTTTTGGGAAG CTCATTCCGGGTGACTTGATCCGCGCGGTGCCATTGGCGCTAAACGTCCATCCTTCGCTA CTTCCCAGACATAAAGGCAGTGCACCTATCCAGCGAGCTCTGCTCGAGGGTGACACTTAC ACCGGTGTAACTATACAGACACTGCATCCGGATCGGTTTGACCATGGTGCAATTGTAGCG CAGACGGAGCCACTGGCGATCGCAACAATGCTGTCAAAAGGGAGAGTCAATGATTCGACG GCAGATTTTAATTCTGAGGGCCTGCCTCGGAGGACTGCCATACTGATGGACCAGTTGGGC GCCCTTGGCGCCCAACTTTTGGGCCAAACGCTTCGTGAGAGGTTATATCTACCACAGAAC CGTGTGCAAGCGCCAACAGCTTACAAACCCAGTTACGCCCACCGTATAACAACAGAAGAT AAACGCATTCATTGGGCGCGCGATTCTGCCGCCGAACTACTTAACAAACTCGAAACGCTC GGTCCTCTGCACGCGTTCAAAGAAGCGACAGCGGCAAGAAAGGACGCTCAAAATTCAGTA TTAAAACGAATATTGTTTCATGAGTGTAAAGTGATGAGAGACGCACGTCTAGATAATGGC AGTAAACCGGGCATGTTCAAATATGATGATATTAAAGACTGTATTTTGGTCACCTGTCGC GGCAACTTACTACTATGTGTGAGCCGCCTCCAGTTCGAAGGTTTCGCCGTAGAACGTGCT GGCCAGTTCATGGCGCGCCTGCGGAAAAGATGCGGCGCCCTGAGTGAAAAGTTAGTTTTC CTGTAA
Protein Properties
Pfam Domain Function
Protein Residues401
Protein Molecular Weight44616.19922
Protein Theoretical pI10.18
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Methionyl-tRNA formyltransferase, mitochondrial MVKMRRITPTRLLFTCRYISNNASPPVQPLNVLFFGSDTFSNFSLQALNELRQNNGSCGI VDNIQVVTRSPKWCGRQKSILKYPPIFDMAEKLQLPRPITCDTKQEMLALSKLTPSRQGN PENDGSGAPFNAIIAVSFGKLIPGDLIRAVPLALNVHPSLLPRHKGSAPIQRALLEGDTY TGVTIQTLHPDRFDHGAIVAQTEPLAIATMLSKGRVNDSTADFNSEGLPRRTAILMDQLG ALGAQLLGQTLRERLYLPQNRVQAPTAYKPSYAHRITTEDKRIHWARDSAAELLNKLETL GPLHAFKEATAARKDAQNSVLKRILFHECKVMRDARLDNGSKPGMFKYDDIKDCILVTCR GNLLLCVSRLQFEGFAVERAGQFMARLRKRCGALSEKLVFL
References
External Links
ResourceLink
Saccharomyces Genome Database FMT1
Uniprot IDP32785
Uniprot NameFMT_YEAST
GenBank Gene IDAY490279
Genebank Protein ID40457276
General Reference
  • Skala, J., Van Dyck, L., Purnelle, B., Goffeau, A. (1992). "The sequence of an 8 kb segment on the left arm of chromosome II from Saccharomyces cerevisiae identifies five new open reading frames of unknown functions, two tRNA genes and two transposable elements." Yeast 8:777-785.1332308
  • Feldmann, H., Aigle, M., Aljinovic, G., Andre, B., Baclet, M. C., Barthe, C., Baur, A., Becam, A. M., Biteau, N., Boles, E., Brandt, T., Brendel, M., Bruckner, M., Bussereau, F., Christiansen, C., Contreras, R., Crouzet, M., Cziepluch, C., Demolis, N., Delaveau, T., Doignon, F., Domdey, H., Dusterhus, S., Dubois, E., Dujon, B., El Bakkoury, M., Entian, K. D., Feurmann, M., Fiers, W., Fobo, G. M., Fritz, C., Gassenhuber, H., Glandsdorff, N., Goffeau, A., Grivell, L. A., de Haan, M., Hein, C., Herbert, C. J., Hollenberg, C. P., Holmstrom, K., Jacq, C., Jacquet, M., Jauniaux, J. C., Jonniaux, J. L., Kallesoe, T., Kiesau, P., Kirchrath, L., Kotter, P., Korol, S., Liebl, S., Logghe, M., Lohan, A. J., Louis, E. J., Li, Z. Y., Maat, M. J., Mallet, L., Mannhaupt, G., Messenguy, F., Miosga, T., Molemans, F., Muller, S., Nasr, F., Obermaier, B., Perea, J., Pierard, A., Piravandi, E., Pohl, F. M., Pohl, T. M., Potier, S., Proft, M., Purnelle, B., Ramezani Rad, M., Rieger, M., Rose, M., Schaaff-Gerstenschlager, I., Scherens, B., Schwarzlose, C., Skala, J., Slonimski, P. P., Smits, P. H., Souciet, J. L., Steensma, H. Y., Stucka, R., Urrestarazu, A., van der Aart, Q. J., van Dyck, L., Vassarotti, A., Vetter, I., Vierendeels, F., Vissers, S., Wagner, G., de Wergifosse, P., Wolfe, K. H., Zagulski, M., Zimmermann, F. K., Mewes, H. W., Kleine, K. (1994). "Complete DNA sequence of yeast chromosome II." EMBO J 13:5795-5809.7813418
  • Li, Y., Holmes, W. B., Appling, D. R., RajBhandary, U. L. (2000). "Initiation of protein synthesis in Saccharomyces cerevisiae mitochondria without formylation of the initiator tRNA." J Bacteriol 182:2886-2892.10781559
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Sickmann, A., Reinders, J., Wagner, Y., Joppich, C., Zahedi, R., Meyer, H. E., Schonfisch, B., Perschil, I., Chacinska, A., Guiard, B., Rehling, P., Pfanner, N., Meisinger, C. (2003). "The proteome of Saccharomyces cerevisiae mitochondria." Proc Natl Acad Sci U S A 100:13207-13212.14576278