You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameGlycerol-3-phosphate O-acyltransferase 1
Synonyms
  • G-3-P acyltransferase 1
  • Dihydroxyacetone phosphate acyltransferase 1
  • DHAP-AT 1
  • Glycerol-3-phosphate / dihydroxyacetone phosphate acyltransferase 1
Gene NameGPT1
Enzyme Class
Biological Properties
General FunctionInvolved in acyltransferase activity
Specific FunctionG-3-P/dihydroxyacetone phosphate dual substrate-specific sn-1 acyltransferase
Cellular LocationMembrane; Multi-pass membrane protein (Probable)
SMPDB Pathways
Cardiolipin Biosynthesis CL(10:0/10:0/12:0/28:1(11Z))PW003504 ThumbThumb?image type=greyscaleThumb?image type=simple
Cardiolipin Biosynthesis CL(10:0/10:0/12:0/28:1(9Z))PW003505 ThumbThumb?image type=greyscaleThumb?image type=simple
Cardiolipin Biosynthesis CL(10:0/10:0/12:0/30:0)PW003506 ThumbThumb?image type=greyscaleThumb?image type=simple
Cardiolipin Biosynthesis CL(10:0/10:0/14:0/24:0)PW003507 ThumbThumb?image type=greyscaleThumb?image type=simple
Cardiolipin Biosynthesis CL(10:0/10:0/14:0/26:0)PW003508 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Glycerophospholipid metabolismec00564 Map00564
SMPDB Reactions
Glycerol 3-phosphate + oleoyl-CoACoenzyme A + 1-oleyl-2-lyso-phosphatidate
Glycerone phosphate + oleoyl-CoACoenzyme A + 1-oleoyl-2-lyso-glycerone phosphate
Glycerol 3-phosphate + hexadec-2-enoyl-CoACoenzyme A + PA(16:0/0:0)
Glycerone phosphate + Palmityl-CoACoenzyme A + 1-palmitoylglycerone 3-phosphate
Glycerol 3-phosphate + hexadec-2-enoyl-CoA Coenzyme A + PA(16:0/0:0)
KEGG Reactions
acyl-CoA + Dihydroxyacetone phosphateCoenzyme A + Dihydroxyacetone phosphate acyl ester
acyl-CoA + Glycerol 3-phosphatePA(18:1(9Z)/0:0) + Coenzyme A + hydron
Metabolites
YMDB IDNameView
YMDB00045Coenzyme AShow
YMDB00073Glycerol 3-phosphateShow
YMDB001871-palmitoylglycerone 3-phosphateShow
YMDB00275Dihydroxyacetone phosphate acyl esterShow
YMDB00301Palmityl-CoAShow
YMDB00322Dihydroxyacetone phosphateShow
YMDB00469hexadec-2-enoyl-CoAShow
YMDB00527palmitoyl-CoAShow
YMDB00539oleoyl-CoAShow
YMDB00862hydronShow
YMDB01160PA(16:0/0:0)Show
YMDB16273Glycerone phosphateShow
YMDB163021-oleyl-2-lyso-phosphatidateShow
YMDB163031-oleoyl-2-lyso-glycerone phosphateShow
GO Classification
Component
Not Available
Function
transferase activity, transferring acyl groups
transferase activity, transferring acyl groups other than amino-acyl groups
acyltransferase activity
catalytic activity
transferase activity
Process
metabolic process
Gene Properties
Chromosome LocationNot Available
LocusYBL011W
Gene Sequence>2280 bp ATGCCTGCACCAAAACTCACGGAGAAATCTGCCTCTTCCAAGAGCACACAGAAAACTACG AATTACAGTTCCATCGAGGCCAAAAGCGTCAAGACGTCGGCTGATCAGGCATACATCTAC CAAGAGCCTAGCGCTACCAAGAAGATACTTTACTCCATCGCCACATGGCTGTTGTACAAC ATCTTCCACTGCTTCTTTAGAGAAATCAGAGGCCGGGGCAGTTTCAAGGTACCGCAACAG GGACCCGTGATCTTTGTTGCGCGTCCGCATGCTAACCAGTTCGTCGACCCTGTAATCCTT ATGGGCGAGGTGAAGAAATCTGTCAACAGACGTGTGTCCTTCTTGATTGCGGAGAGCTCA TTAAAGCAACCCGCCATAGGGTTTTTGGCTAGTTTCTTCATGGCCATAGGCGTGGTAAGG CCGCAGGATAATTTGAAACCGGCAGAAGGTACTATCCGCGTAGATCCAACAGACTACAAG AGAGTTATCGGCCACGACACGCATTTCTTGACTGATTGTATGCCAAAGGGTCTCATCGGG TTACCCAAATCAATGGGATTTGGAGAAATCCAGTCCATAGAAAGTGACACGAGTTTGACT CTAAGAAAAGAGTTCAAAATGGCCAAACCAGAGATTAAAACCGCCTTACTCACCGGCACT ACTTATAAATATGCCGCCAAAGTCGACCAATCTTGCGTTTACCATAGAGTTTTTGAGCAT TTGGCCCATAACAACTGCATTGGGATCTTTCCTGAAGGTGGGTCCCACGACAGAACAAAC TTGTTGCCCCTGAAAGCAGGTGTGGCGATTATGGCTCTTGGTTGCATGGATAAGCATCCT GACGTCAATGTTAAGATTGTTCCCTGTGGTATGAATTATTTCCATCCACATAAGTTCAGG TCGAGAGCGGTTGTTGAATTTGGTGACCCCATTGAAATACCGAAGGAACTAGTCGCCAAG TACCACAACCCGGAAACGAACAGAGATGCAGTGAAAGAGTTATTAGATACCATATCGAAG GGTTTACAATCCGTTACCGTTACATGTTCTGATTATGAAACTTTGATGGTGGTTCAAACG ATAAGAAGACTATATATGACACAATTTAGCACCAAGTTACCGTTGCCCTTGATTGTGGAA ATGAACAGAAGAATGGTCAAAGGTTACGAATTCTATAGAAACGATCCTAAAATAGCGGAC TTGACCAAAGATATAATGGCATATAATGCCGCCTTGAGACACTATAATCTTCCTGATCAC CTTGTGGAGGAGGCAAAGGTAAATTTCGCAAAAAACCTCGGACTTGTTTTTTTTAGATCC ATCGGGCTCTGCATCCTCTTTTCGTTAGCCATGCCAGGTATCATTATGTTCTCACCTGTC TTCATATTAGCCAAGAGAATTTCTCAAGAAAAGGCCCGTACCGCTTTGTCCAAGTCTACA GTTAAAATAAAGGCTAACGATGTCATTGCCACGTGGAAAATCTTGATTGGGATGGGATTT GCGCCCTTGCTTTACATCTTTTGGTCCGTTTTAATCACTTATTACCTCAGACATAAACCA TGGAATAAAATATATGTTTTTTCCGGGTCTTACATCTCGTGTGTTATAGTCACATATTCA GCCTTAATCGTGGGTGATATTGGTATGGATGGTTTCAAATCTTTGAGACCACTGGTTTTA TCTCTTACATCTCCAAAGGGCTTGCAAAAGCTACAAAAGGATCGTAGAAATCTGGCAGAA AGAATAATCGAAGTTGTAAATAACTTTGGAAGCGAATTATTCCCCGATTTCGATAGTGCC GCCCTACGTGAAGAATTCGACGTCATCGATGAAGAGGAAGAAGACCGAAAAACCTCAGAA TTGAATCGCAGGAAAATGCTAAGAAAACAGAAAATAAAAAGACAAGAAAAAGATTCGTCA TCACCTATCATCAGCCAACGTGACAACCACGATGCCTATGAACACCATAACCAAGATTCA GATGGCGTCTCATTGGTCAATAGTGACAATTCCCTCTCTAATATTCCATTATTCTCTTCT ACTTTTCATCGTAAGTCAGAGTCTTCCTTAGCTTCGACATCCGTTGCACCTTCTTCTTCC TCCGAATTTGAGGTAGAAAACGAAATCTTGGAGGAAAAAAATGGATTAGCAAGTAAAATC GCACAGGCCGTCTTAAACAAGAGAATTAGTGAAAATACTGCCAGGGAAGAGGAAGAGGAA GAAGAAGAGGAAGAAGAAGAAGAGGAAGAAGAAGAAGAAGGGAAAGAAGGAGATGCGTAG
Protein Properties
Pfam Domain Function
Protein Residues759
Protein Molecular Weight85693.5
Protein Theoretical pI7.3
Signalling Regions
  • None
Transmembrane Regions
  • 49-66
  • 123-139
  • 260-276
  • 440-463
  • 494-516
  • 524-545
Protein Sequence>Glycerol-3-phosphate O-acyltransferase 1 MPAPKLTEKFASSKSTQKTTNYSSIEAKSVKTSADQAYIYQEPSATKKILYSIATWLLYN IFHCFFREIRGRGSFKVPQQGPVIFVAAPHANQFVDPVILMGEVKKSVNRRVSFLIAESS LKQPPIGFLASFFMAIGVVRPQDNLKPAEGTIRVDPTDYKRVIGHDTHFLTDCMPKGLIG LPKSMGFGEIQSIESDTSLTLRKEFKMAKPEIKTALLTGTTYKYAAKVDQSCVYHRVFEH LAHNNCIGIFPEGGSHDRTNLLPLKAGVAIMALGCMDKHPDVNVKIVPCGMNYFHPHKFR SRAVVEFGDPIEIPKELVAKYHNPETNRDAVKELLDTISKGLQSVTVTCSDYETLMVVQT IRRLYMTQFSTKLPLPLIVEMNRRMVKGYEFYRNDPKIADLTKDIMAYNAALRHYNLPDH LVEEAKVNFAKNLGLVFFRSIGLCILFSLAMPGIIMFSPVFILAKRISQEKARTALSKST VKIKANDVIATWKILIGMGFAPLLYIFWSVLITYYLRHKPWNKIYVFSGSYISCVIVTYS ALIVGDIGMDGFKSLRPLVLSLTSPKGLQKLQKDRRNLAERIIEVVNNFGSELFPDFDSA ALREEFDVIDEEEEDRKTSELNRRKMLRKQKIKRQEKDSSSPIISQRDNHDAYEHHNQDS DGVSLVNSDNSLSNIPLFSSTFHRKSESSLASTSVAPSSSSEFEVENEILEEKNGLASKI AQAVLNKRIGENTAREEEEEEEEEEEEEEEEEEGKEGDA
References
External Links
ResourceLink
Saccharomyces Genome Database GPT1
Uniprot IDP32784
Uniprot NameGPT1_YEAST
GenBank Gene IDD38256
Genebank Protein ID793767
General Reference
  • Matsushita, M., Nikawa, J. (1995). "Isolation and characterization of a SCT1 gene which can suppress a choline-transport mutant of Saccharomyces cerevisiae." J Biochem 117:447-451.7608137
  • Zheng, Z., Zou, J. (2001). "The initial step of the glycerolipid pathway: identification of glycerol 3-phosphate/dihydroxyacetone phosphate dual substrate acyltransferases in Saccharomyces cerevisiae." J Biol Chem 276:41710-41716.11544256
  • Skala, J., Van Dyck, L., Purnelle, B., Goffeau, A. (1992). "The sequence of an 8 kb segment on the left arm of chromosome II from Saccharomyces cerevisiae identifies five new open reading frames of unknown functions, two tRNA genes and two transposable elements." Yeast 8:777-785.1332308
  • Feldmann, H., Aigle, M., Aljinovic, G., Andre, B., Baclet, M. C., Barthe, C., Baur, A., Becam, A. M., Biteau, N., Boles, E., Brandt, T., Brendel, M., Bruckner, M., Bussereau, F., Christiansen, C., Contreras, R., Crouzet, M., Cziepluch, C., Demolis, N., Delaveau, T., Doignon, F., Domdey, H., Dusterhus, S., Dubois, E., Dujon, B., El Bakkoury, M., Entian, K. D., Feurmann, M., Fiers, W., Fobo, G. M., Fritz, C., Gassenhuber, H., Glandsdorff, N., Goffeau, A., Grivell, L. A., de Haan, M., Hein, C., Herbert, C. J., Hollenberg, C. P., Holmstrom, K., Jacq, C., Jacquet, M., Jauniaux, J. C., Jonniaux, J. L., Kallesoe, T., Kiesau, P., Kirchrath, L., Kotter, P., Korol, S., Liebl, S., Logghe, M., Lohan, A. J., Louis, E. J., Li, Z. Y., Maat, M. J., Mallet, L., Mannhaupt, G., Messenguy, F., Miosga, T., Molemans, F., Muller, S., Nasr, F., Obermaier, B., Perea, J., Pierard, A., Piravandi, E., Pohl, F. M., Pohl, T. M., Potier, S., Proft, M., Purnelle, B., Ramezani Rad, M., Rieger, M., Rose, M., Schaaff-Gerstenschlager, I., Scherens, B., Schwarzlose, C., Skala, J., Slonimski, P. P., Smits, P. H., Souciet, J. L., Steensma, H. Y., Stucka, R., Urrestarazu, A., van der Aart, Q. J., van Dyck, L., Vassarotti, A., Vetter, I., Vierendeels, F., Vissers, S., Wagner, G., de Wergifosse, P., Wolfe, K. H., Zagulski, M., Zimmermann, F. K., Mewes, H. W., Kleine, K. (1994). "Complete DNA sequence of yeast chromosome II." EMBO J 13:5795-5809.7813418
  • Delaveau, T., Jacq, C., Perea, J. (1992). "Sequence of a 12.7 kb segment of yeast chromosome II identifies a PDR-like gene and several new open reading frames." Yeast 8:761-768.1441753
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956