You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameMonothiol glutaredoxin-4
SynonymsNot Available
Gene NameGRX4
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in electron carrier activity
Specific FunctionMonothiol glutaredoxin involved in the biogenesis of iron-sulfur clusters. Binds one iron-sulfur cluster per dimer. The iron-sulfur cluster is bound between subunits, and is complexed by a bound glutathione and a cysteine residue from each subunit (Probable)
Cellular LocationNot Available
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00057Oxidized glutathioneShow
YMDB00160GlutathioneShow
YMDB00426NADPHShow
YMDB00427NADPShow
YMDB00693glutathione disulfideShow
YMDB00862hydronShow
GO Classification
Component
Not Available
Function
disulfide oxidoreductase activity
protein disulfide oxidoreductase activity
catalytic activity
oxidoreductase activity
electron carrier activity
oxidoreductase activity, acting on a sulfur group of donors
Process
cellular process
cellular homeostasis
cell redox homeostasis
Gene Properties
Chromosome Locationchromosome 5
LocusYER174C
Gene Sequence>735 bp ATGACTGTGGTTGAAATAAAAAGCCAGGACCAATTTACGCAACTAACCACTACAAACGCT GCTAATAAACTCATTGTCTTATATTTTAAAGCTCAATGGGCTGATCCTTGCAAAACTATG AGCCAGGTGCTAGAAGCTGTTAGTGAAAAAGTTAGGCAAGAGGATGTCCGGTTTTTATCA ATAGATGCAGACGAACATCCAGAAATATCAGACCTTTTTGAGATTGCAGCCGTACCATAC TTCGTCTTCATTCAAAATGGTACTATTGTAAAAGAAATATCAGCCGCAGATCCTAAGGAG TTTGTGAAAAGCTTAGAAATTCTTTCGAATGCTTCTGCCTCACTAGCGAACAATGCCAAG GGTCCTAAATCTACGTCTGATGAGGAAAGCAGCGGGTCTTCCGATGATGAAGAGGACGAA ACTGAAGAAGAAATAAATGCTAGGCTGGTGAAGCTAGTACAAGCTGCACCTGTGATGCTA TTCATGAAAGGAAGCCCATCAGAACCTAAATGCGGATTTTCTAGACAGTTAGTTGGTATC CTCAGAGAACACCAAATAAGGTTCGGATTTTTTGATATATTAAGAGACGAAAACGTTAGA CAAAGCTTGAAGAAGTTTTCTGATTGGCCTACTTTTCCTCAGTTATATATCAATGGGGAG TTCCAGGGAGGTTTGGATATTATCAAGGAATCTATAGAAGAAGATCCTGAATATTTCCAA CATGCTCTACAGTAA
Protein Properties
Pfam Domain Function
Protein Residues244
Protein Molecular Weight27492.59961
Protein Theoretical pI4.29
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Monothiol glutaredoxin-4 MTVVEIKSQDQFTQLTTTNAANKLIVLYFKAQWADPCKTMSQVLEAVSEKVRQEDVRFLS IDADEHPEISDLFEIAAVPYFVFIQNGTIVKEISAADPKEFVKSLEILSNASASLANNAK GPKSTSDEESSGSSDDEEDETEEEINARLVKLVQAAPVMLFMKGSPSEPKCGFSRQLVGI LREHQIRFGFFDILRDENVRQSLKKFSDWPTFPQLYINGEFQGGLDIIKESIEEDPEYFQ HALQ
References
External Links
ResourceLink
Saccharomyces Genome Database GRX4
Uniprot IDP32642
Uniprot NameGLRX4_YEAST
GenBank Gene IDU18922
Genebank Protein ID603415
General Reference
  • Dietrich, F. S., Mulligan, J., Hennessy, K., Yelton, M. A., Allen, E., Araujo, R., Aviles, E., Berno, A., Brennan, T., Carpenter, J., Chen, E., Cherry, J. M., Chung, E., Duncan, M., Guzman, E., Hartzell, G., Hunicke-Smith, S., Hyman, R. W., Kayser, A., Komp, C., Lashkari, D., Lew, H., Lin, D., Mosedale, D., Davis, R. W., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome V." Nature 387:78-81.9169868
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Li, H., Mapolelo, D. T., Dingra, N. N., Naik, S. G., Lees, N. S., Hoffman, B. M., Riggs-Gelasco, P. J., Huynh, B. H., Johnson, M. K., Outten, C. E. (2009). "The yeast iron regulatory proteins Grx3/4 and Fra2 form heterodimeric complexes containing a [2Fe-2S] cluster with cysteinyl and histidyl ligation." Biochemistry 48:9569-9581.19715344