You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameFructose-2,6-bisphosphatase
SynonymsNot Available
Gene NameFBP26
Enzyme Class
Biological Properties
General FunctionInvolved in catalytic activity
Specific FunctionThis is predominantly if not solely a fructose-2,6- bisphosphatase
Cellular LocationNot Available
SMPDB Pathways
Fructose MetabolismPW002390 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Fructose and mannose metabolismec00051 Map00051
SMPDB Reactions
D-Fructose 2,6-bisphosphate + waterphosphate + β-D-fructofuranose 6-phosphate
KEGG Reactions
D-Fructose 2,6-bisphosphate + waterFructose 6-phosphate + phosphate
Metabolites
YMDB IDNameView
YMDB00011D-Fructose 2,6-bisphosphateShow
YMDB00078Fructose 6-phosphateShow
YMDB00890waterShow
YMDB00907phosphateShow
YMDB16262β-D-fructofuranose 6-phosphateShow
GO Classification
Component
Not Available
Function
transferase activity, transferring phosphorus-containing groups
binding
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
ATP binding
phosphotransferase activity, alcohol group as acceptor
catalytic activity
phosphofructokinase activity
transferase activity
6-phosphofructo-2-kinase activity
Process
metabolic process
fructose metabolic process
fructose 2,6-bisphosphate metabolic process
small molecule metabolic process
alcohol metabolic process
monosaccharide metabolic process
hexose metabolic process
Gene Properties
Chromosome Locationchromosome 10
LocusYJL155C
Gene Sequence>1359 bp ATGGGGTACAGTACTATTTCCAACGATAATGATATCAAAGTATGTGTGATAATGGTTGGC CTACCAGCTAGAGGAAAGTCTTTTATTTCCCAAAAAATTATCAGGTACTTATCGTGGTTA TCCATAAAAGCCAAGTGTTTTAATGTGGGAAATTACAGAAGAGACGTGAGTGGAAATGTC CCAATGGATGCTGAGTTTTTTAACTTCGAAAATACAGATAATTTTAAACTCAGAGAATTG GCTGCCCAAAATGCCATAAAAGATATTGTTAATTTTTTTACTAAAGAAGACGGATCTGTG GCAGTTTTCGATGCTACTAATAGTACACGTAAAAGAAGGAAATGGCTTAAAGATATATGT GAAAAGAATAATATTCAACCGATGTTTTTAGAGAGCTGGAGTAACGATCATGAACTGATT ATAAATAACGCTAAGGATATCGGTAGCACATCTCCTGATTATGAAAACTCTGAACCTCAT GTGGCGGAAGCTGATTTTTTGGAAAGAATTAGACAATATGAAAGATTTTATGAACCTTTG GACCCCCAAAAAGATAAGGATATGACGTTCATTAAGTTGGTCAATATTATTGAACAAGTA GTAATTAATAAGATCAGAACATATTTGGAAAGTAGGATTGTATTTTATGTTATGAATATT CGTCCTAAACCAAAATATATCTGGCTCTCCCGTCACGGCGAATCGATCTATAACGTAGAG AAAAAAATTGGCGGGGATTCATCACTGTCTGAAAGAGGCTTTCAGTACGCTAAAAAATTG GAGCAGTTAGTGAAAGAGAGCGCAGGAGAAATAAATTTGACCGTGTGGACTTCCACCTTA AAAAGAACACAACAAACGGCAAATTATCTTCCCTATAAGAAACTGCAATGGAAAGCACTT GATGAATTAGACGCTGGCGTTTGTGACGGAATGACGTATGAGGAAATTGAAAAAGAATAT CCTGAAGATTTTAAAGCACGTGATAATGACAAATACGAGTACAGATATCGTGGTGGAGAA TCATACAGAGATGTAGTGATTCGTTTAGAGCCCGTCATTATGGAATTGGAGCGCCAAGAA AATGAACTCATTATAACTCATCAAGCCGTACTTCGGTGTATATATGCATATTTTATGAAC GTTCCACAGGAGGAATCCCCTTGGATGTCAATCCCACTACACACATTGATCAAGCTGGAG CCTAGGGCCTATGGCACAAAGGTCACCAAAATTAAAGCAAACATCCCTGCAGTGAGTACA TATAAAGAGAAGGGTACAAGCCAAGTAGGTGAGCTTTCTCAAAGCTCAACTAAACTTCAT CAACTGCTCAATGACTCTCCTTTCCAAGACAAATTTTAA
Protein Properties
Pfam Domain Function
Protein Residues452
Protein Molecular Weight52594.5
Protein Theoretical pI6.8
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Fructose-2,6-bisphosphatase MGYSTISNDNDIKVCVIMVGLPARGKSFISQKIIRYLSWLSIKAKCFNVGNYRRDVSGNV PMDAEFFNFENTDNFKLRELAAQNAIKDIVNFFTKEDGSVAVFDATNSTRKRRKWLKDIC EKNNIQPMFLESWSNDHELIINNAKDIGSTSPDYENSEPHVAEADFLERIRQYERFYEPL DPQKDKDMTFIKLVNIIEEVVINKIRTYLESRIVFYVMNIRPKPKYIWLSRHGESIYNVE KKIGGDSSLSERGFQYAKKLEQLVKESAGEINLTVWTSTLKRTQQTANYLPYKKLQWKAL DELDAGVCDGMTYEEIEKEYPEDFKARDNDKYEYRYRGGESYRDVVIRLEPVIMELERQE NVLIITHQAVLRCIYAYFMNVPQEESPWMSIPLHTLIKLEPRAYGTKVTKIKANIPAVST YKEKGTSQVGELSQSSTKLHQLLNDSPLEDKF
References
External Links
ResourceLink
Saccharomyces Genome Database FBP26
Uniprot IDP32604
Uniprot NameF26_YEAST
GenBank Gene IDS42124
Genebank Protein ID253335
General Reference
  • Paravicini, G., Kretschmer, M. (1992). "The yeast FBP26 gene codes for a fructose-2,6-bisphosphatase." Biochemistry 31:7126-7133.1322693
  • Galibert, F., Alexandraki, D., Baur, A., Boles, E., Chalwatzis, N., Chuat, J. C., Coster, F., Cziepluch, C., De Haan, M., Domdey, H., Durand, P., Entian, K. D., Gatius, M., Goffeau, A., Grivell, L. A., Hennemann, A., Herbert, C. J., Heumann, K., Hilger, F., Hollenberg, C. P., Huang, M. E., Jacq, C., Jauniaux, J. C., Katsoulou, C., Karpfinger-Hartl, L., et, a. l. .. (1996). "Complete nucleotide sequence of Saccharomyces cerevisiae chromosome X." EMBO J 15:2031-2049.8641269
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Li, X., Gerber, S. A., Rudner, A. D., Beausoleil, S. A., Haas, W., Villen, J., Elias, J. E., Gygi, S. P. (2007). "Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae." J Proteome Res 6:1190-1197.17330950
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956