You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameFructose-2,6-bisphosphatase
SynonymsNot Available
Gene NameFBP26
Enzyme Class
Biological Properties
General FunctionInvolved in catalytic activity
Specific FunctionThis is predominantly if not solely a fructose-2,6- bisphosphatase
Cellular LocationNot Available
SMPDB Pathways
Fructose MetabolismPW002390 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Fructose and mannose metabolismec00051 Map00051
SMPDB Reactions
D-Fructose 2,6-bisphosphate + waterphosphate + β-D-fructofuranose 6-phosphate
KEGG Reactions
D-Fructose 2,6-bisphosphate + waterFructose 6-phosphate + phosphate
Metabolites
YMDB IDNameView
YMDB00011D-Fructose 2,6-bisphosphateShow
YMDB00078Fructose 6-phosphateShow
YMDB00890waterShow
YMDB00907phosphateShow
YMDB16262β-D-fructofuranose 6-phosphateShow
GO Classification
Component
Not Available
Function
catalytic activity
phosphofructokinase activity
transferase activity
6-phosphofructo-2-kinase activity
transferase activity, transferring phosphorus-containing groups
binding
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
ATP binding
phosphotransferase activity, alcohol group as acceptor
Process
hexose metabolic process
metabolic process
fructose metabolic process
fructose 2,6-bisphosphate metabolic process
small molecule metabolic process
alcohol metabolic process
monosaccharide metabolic process
Gene Properties
Chromosome Locationchromosome 10
LocusYJL155C
Gene Sequence>1359 bp ATGGGGTACAGTACTATTTCCAACGATAATGATATCAAAGTATGTGTGATAATGGTTGGC CTACCAGCTAGAGGAAAGTCTTTTATTTCCCAAAAAATTATCAGGTACTTATCGTGGTTA TCCATAAAAGCCAAGTGTTTTAATGTGGGAAATTACAGAAGAGACGTGAGTGGAAATGTC CCAATGGATGCTGAGTTTTTTAACTTCGAAAATACAGATAATTTTAAACTCAGAGAATTG GCTGCCCAAAATGCCATAAAAGATATTGTTAATTTTTTTACTAAAGAAGACGGATCTGTG GCAGTTTTCGATGCTACTAATAGTACACGTAAAAGAAGGAAATGGCTTAAAGATATATGT GAAAAGAATAATATTCAACCGATGTTTTTAGAGAGCTGGAGTAACGATCATGAACTGATT ATAAATAACGCTAAGGATATCGGTAGCACATCTCCTGATTATGAAAACTCTGAACCTCAT GTGGCGGAAGCTGATTTTTTGGAAAGAATTAGACAATATGAAAGATTTTATGAACCTTTG GACCCCCAAAAAGATAAGGATATGACGTTCATTAAGTTGGTCAATATTATTGAACAAGTA GTAATTAATAAGATCAGAACATATTTGGAAAGTAGGATTGTATTTTATGTTATGAATATT CGTCCTAAACCAAAATATATCTGGCTCTCCCGTCACGGCGAATCGATCTATAACGTAGAG AAAAAAATTGGCGGGGATTCATCACTGTCTGAAAGAGGCTTTCAGTACGCTAAAAAATTG GAGCAGTTAGTGAAAGAGAGCGCAGGAGAAATAAATTTGACCGTGTGGACTTCCACCTTA AAAAGAACACAACAAACGGCAAATTATCTTCCCTATAAGAAACTGCAATGGAAAGCACTT GATGAATTAGACGCTGGCGTTTGTGACGGAATGACGTATGAGGAAATTGAAAAAGAATAT CCTGAAGATTTTAAAGCACGTGATAATGACAAATACGAGTACAGATATCGTGGTGGAGAA TCATACAGAGATGTAGTGATTCGTTTAGAGCCCGTCATTATGGAATTGGAGCGCCAAGAA AATGAACTCATTATAACTCATCAAGCCGTACTTCGGTGTATATATGCATATTTTATGAAC GTTCCACAGGAGGAATCCCCTTGGATGTCAATCCCACTACACACATTGATCAAGCTGGAG CCTAGGGCCTATGGCACAAAGGTCACCAAAATTAAAGCAAACATCCCTGCAGTGAGTACA TATAAAGAGAAGGGTACAAGCCAAGTAGGTGAGCTTTCTCAAAGCTCAACTAAACTTCAT CAACTGCTCAATGACTCTCCTTTCCAAGACAAATTTTAA
Protein Properties
Pfam Domain Function
Protein Residues452
Protein Molecular Weight52594.5
Protein Theoretical pI6.8
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Fructose-2,6-bisphosphatase MGYSTISNDNDIKVCVIMVGLPARGKSFISQKIIRYLSWLSIKAKCFNVGNYRRDVSGNV PMDAEFFNFENTDNFKLRELAAQNAIKDIVNFFTKEDGSVAVFDATNSTRKRRKWLKDIC EKNNIQPMFLESWSNDHELIINNAKDIGSTSPDYENSEPHVAEADFLERIRQYERFYEPL DPQKDKDMTFIKLVNIIEEVVINKIRTYLESRIVFYVMNIRPKPKYIWLSRHGESIYNVE KKIGGDSSLSERGFQYAKKLEQLVKESAGEINLTVWTSTLKRTQQTANYLPYKKLQWKAL DELDAGVCDGMTYEEIEKEYPEDFKARDNDKYEYRYRGGESYRDVVIRLEPVIMELERQE NVLIITHQAVLRCIYAYFMNVPQEESPWMSIPLHTLIKLEPRAYGTKVTKIKANIPAVST YKEKGTSQVGELSQSSTKLHQLLNDSPLEDKF
References
External Links
ResourceLink
Saccharomyces Genome Database FBP26
Uniprot IDP32604
Uniprot NameF26_YEAST
GenBank Gene IDS42124
Genebank Protein ID253335
General Reference
  • Paravicini, G., Kretschmer, M. (1992). "The yeast FBP26 gene codes for a fructose-2,6-bisphosphatase." Biochemistry 31:7126-7133.1322693
  • Galibert, F., Alexandraki, D., Baur, A., Boles, E., Chalwatzis, N., Chuat, J. C., Coster, F., Cziepluch, C., De Haan, M., Domdey, H., Durand, P., Entian, K. D., Gatius, M., Goffeau, A., Grivell, L. A., Hennemann, A., Herbert, C. J., Heumann, K., Hilger, F., Hollenberg, C. P., Huang, M. E., Jacq, C., Jauniaux, J. C., Katsoulou, C., Karpfinger-Hartl, L., et, a. l. .. (1996). "Complete nucleotide sequence of Saccharomyces cerevisiae chromosome X." EMBO J 15:2031-2049.8641269
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Li, X., Gerber, S. A., Rudner, A. D., Beausoleil, S. A., Haas, W., Villen, J., Elias, J. E., Gygi, S. P. (2007). "Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae." J Proteome Res 6:1190-1197.17330950
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956