You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameSporulation-specific glucan 1,3-beta-glucosidase
Synonyms
  • Exo-1,3-beta-glucanase
Gene NameSPR1
Enzyme Class
Biological Properties
General FunctionInvolved in hydrolase activity, hydrolyzing O-glycosyl compounds
Specific FunctionProbably involved in the processes of spore formation and contributes to ascospore thermoresistance by participating in the morphogenesis of ascospore walls. The enzyme may do this by modifying glucan linkages in the developing ascospore wall, thus strengthening it or lending it plasticity
Cellular LocationSecreted
SMPDB Pathways
Starch and sucrose metabolismPW002481 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Starch and sucrose metabolismec00500 Map00500
SMPDB Reactions
Alpha-D-Glucose + 1,3-beta-D-Glucan1,3-beta-D-Glucan + water
KEGG Reactions
water + (1->3)-beta-D-glucan D-Glucose
Metabolites
YMDB IDNameView
YMDB00273Alpha-D-GlucoseShow
YMDB00286D-GlucoseShow
YMDB00890waterShow
YMDB163141,3-beta-D-GlucanShow
GO Classification
Component
Not Available
Function
binding
ion binding
cation binding
hydrolase activity
hydrolase activity, acting on glycosyl bonds
hydrolase activity, hydrolyzing O-glycosyl compounds
catalytic activity
Process
primary metabolic process
carbohydrate metabolic process
metabolic process
Gene Properties
Chromosome Locationchromosome 15
LocusYOR190W
Gene Sequence>1338 bp ATGGTTTCGTTCAGAGGGCTGACTACACTAACACTACTTTTTACCAAATTAGTAAACTGT AATCCTGTTTCCACAAAAAATAGGGACTCTATACAGTTTATTTATAAAGAAAAGGATAGT ATATACTCTGCCATCAACAATCAAGCCATCAATGAAAAAATTCATGGAGTCAATTTGGGT GGGTGGCTAGTATTGGAGCCGTATATTACACCTTCTTTATTCGAGACTTTCCGTACTAAT CCGTACAACGATGACGGTATTCCTGTTGATGAATACCATTTTTGTGAAAAATTAGGCTAT GAAAAGGCAAAGGAACGCCTTTATAGTCATTGGTCGACGTTCTATAAAGAGGAAGACTTC GCGAAAATTGCTTCTCAAGGCTTCAATTTGGTTAGAATTCCTATTGGGTATTGGGCCTTT ACAACGTTGAGTCATGATCCCTATGTTACCGCCGAGCAGGAATATTTTCTAGACCGGGCT ATCGATTGGGCTAGGAAATATGGTTTGAAAGTATGGATTGATCTTCATGGAGCCGCTGGT TCACAAAACGGATTTGATAACTCAGGGTTGAGGGATTCATATAAGTTTCTGGAAGATGAA AATTTAAGCGCCACCATGAAAGCTTTAACGTATATTTTAAGCAAATACTCAACAGACGTA TACCTGGACACCGTTATTGGAATCGAATTGCTCAATGAACCGTTAGGTCCAGTTATTGAC ATGGAAAGATTGAAAAATTTGCTTTTGAAGCCGGCTTATGACTATTTGAGAAATAAAATT AATAGCAACCAGATCATTGTAATACATGATGCTTTTCAACCTTACCATTATTGGGATGGG TTTTTGAATGATGAAAAGAACGAATATGGCGTCATAATTGACCATCATCATTATCAGGTG TTCTCGCAGGTGGAATTAACAAGAAAAATGAATGAACGTATCAAAATCGCCTGCCAATGG GGGAAAGATGCCGTAAGCGAGAAGCATTGGTCCGTAGCAGGCGAATTTTCAGCGGCCTTA ACAGATTGTACAAAGTGGTTAAATGGGGTTGGTCTAGGTGCCAGATATGATGGAAGTTGG ACCAAAGACAATGAAAAATCTCATTACATAAATACGTGTGCAAACAACGAGAATATTGCC TTGTGGCCCGAAGAGAGAAAACAGAACACTAGAAAGTTTATCGAGGCTCAATTAGATGCT TTTGAAATGACTGGTGGATGGATAATGTGGTGTTACAAGACAGAGAATAGTATCGAATGG GATGTTGAAAAATTGATTCAACTCAACATTTTTCCGCAACCTATCAACGATAGGAAATAT CCTAACCAATGTCATTGA
Protein Properties
Pfam Domain Function
Protein Residues445
Protein Molecular Weight51809.10156
Protein Theoretical pI5.61
Signalling Regions
  • 1-21
Transmembrane Regions
  • None
Protein Sequence>Sporulation-specific glucan 1,3-beta-glucosidase MVSFRGLTTLTLLFTKLVNCNPVSTKNRDSIQFIYKEKDSIYSAINNQAINEKIHGVNLG GWLVLEPYITPSLFETFRTNPYNDDGIPVDEYHFCEKLGYEKAKERLYSHWSTFYKEEDF AKIASQGFNLVRIPIGYWAFTTLSHDPYVTAEQEYFLDRAIDWARKYGLKVWIDLHGAAG SQNGFDNSGLRDSYKFLEDENLSATMKALTYILSKYSTDVYLDTVIGIELLNEPLGPVID MERLKNLLLKPAYDYLRNKINSNQIIVIHDAFQPYHYWDGFLNDEKNEYGVIIDHHHYQV FSQVELTRKMNERIKIACQWGKDAVSEKHWSVAGEFSAALTDCTKWLNGVGLGARYDGSW TKDNEKSHYINTCANNENIALWPEERKQNTRKFIEAQLDAFEMTGGWIMWCYKTENSIEW DVEKLIQLNIFPQPINDRKYPNQCH
References
External Links
ResourceLink
Saccharomyces Genome Database SPR1
Uniprot IDP32603
Uniprot NameSPR1_YEAST
GenBank Gene IDAY723868
Genebank Protein ID51830530
General Reference
  • Muthukumar, G., Suhng, S. H., Magee, P. T., Jewell, R. D., Primerano, D. A. (1993). "The Saccharomyces cerevisiae SPR1 gene encodes a sporulation-specific exo-1,3-beta-glucanase which contributes to ascospore thermoresistance." J Bacteriol 175:386-394.8419289
  • San Segundo, P., Correa, J., Vazquez de Aldana, C. R., del Rey, F. (1993). "SSG1, a gene encoding a sporulation-specific 1,3-beta-glucanase in Saccharomyces cerevisiae." J Bacteriol 175:3823-3837.8509335
  • Dujon, B., Albermann, K., Aldea, M., Alexandraki, D., Ansorge, W., Arino, J., Benes, V., Bohn, C., Bolotin-Fukuhara, M., Bordonne, R., Boyer, J., Camasses, A., Casamayor, A., Casas, C., Cheret, G., Cziepluch, C., Daignan-Fornier, B., Dang, D. V., de Haan, M., Delius, H., Durand, P., Fairhead, C., Feldmann, H., Gaillon, L., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XV." Nature 387:98-102.9169874
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287