Canmetcon
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameProtein-S-isoprenylcysteine O-methyltransferase
Synonyms
  • Isoprenylcysteine carboxylmethyltransferase
  • Prenylated protein carboxyl methyltransferase
  • PPMT
  • Prenylcysteine carboxyl methyltransferase
  • pcCMT
Gene NameSTE14
Enzyme Class
Biological Properties
General FunctionInvolved in protein C-terminal S-isoprenylcysteine carboxyl O-methyltransferase activity
Specific FunctionMediates C-terminal methylation of the isoprenylated C- terminal cysteine in A-factor mating pheromone and Ras proteins
Cellular LocationMembrane; Multi-pass membrane protein (Probable)
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00198S-AdenosylhomocysteineShow
YMDB00297S-AdenosylmethionineShow
YMDB00438S-Adenosyl-L-methionineShow
GO Classification
Component
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
transferase activity, transferring one-carbon groups
catalytic activity
methyltransferase activity
transferase activity
protein methyltransferase activity
protein carboxyl O-methyltransferase activity
protein C-terminal carboxyl O-methyltransferase activity
protein C-terminal S-isoprenylcysteine carboxyl O-methyltransferase activity
Process
post-translational protein modification
metabolic process
macromolecule metabolic process
macromolecule modification
protein modification process
protein amino acid alkylation
protein amino acid methylation
C-terminal protein amino acid methylation
Gene Properties
Chromosome Locationchromosome 4
LocusYDR410C
Gene Sequence>720 bp ATGCACCAAGATTTTCAAGAAGACGAGCATGAGTATCCAGACATCAGACGCAATCCGCTG CATGAGGTGACCATGACTTCCTACATACTGGGGATTCTTTTAGGTATATTTGTTGGTCTT TTTCCACAAATTAGATTCAAGAATTTTAACCTCTTTATTATTGCCCTGTCCTTATTCCAT TTTTTGGAGTATTATATTACAGCTAAATACAATCCTCTTAAGGTACATTCAGAGTCCTTT CTTCTGAACAACGGCAAAAGTTACATGGCGGCACATTCCTTTGCTATTCTGGAATGCCTC GTAGAAAGCTTTCTTTTTCCTGATCTGAAAATTTTTAGCTACTCTCTAGCTACCAAGCTT TGTACAGTACTTGGATGTCTTCTAGTTATTCTGGGACAATATACCAGAACTATTGCTATG CATACTGCGGGACATTCCTTTTCTCATATTGTGAAGACCAAGAAGGAGTCCGATCATGTT TTAGTGAAAACTGGCGTTTACTCCTGGTCAAGACATCCAAGTTATCTTGGGTTCTTTTGG TGGGCAATTGGCACTCAGCTACTGCTTCTAAATCCCCTATCATTGGTTATTTTCATTTTT GTACTTTGGAAATTTTTCAGTGATAGAATTCGTGTGGAAGAAAAATATTTGATAGAGTTC TTTAGCGCGGAATACATAGAATACAAGAATAAGGTTGGTGTCGGAATACCTTTTATATAA
Protein Properties
Pfam Domain Function
Protein Residues239
Protein Molecular Weight27887.40039
Protein Theoretical pI8.11
Signalling Regions
  • None
Transmembrane Regions
  • 24-44
  • 48-68
  • 89-109
  • 111-131
  • 183-203
Protein Sequence>Protein-S-isoprenylcysteine O-methyltransferase MHQDFQEDEHEYPDIRRNPLHEVTMTSYILGILLGIFVGLFPQIRFKNFNLFIIALSLFH FLEYYITAKYNPLKVHSESFLLNNGKSYMAAHSFAILECLVESFLFPDLKIFSYSLATKL CTVLGCLLVILGQYTRTIAMHTAGHSFSHIVKTKKESDHVLVKTGVYSWSRHPSYLGFFW WAIGTQLLLLNPLSLVIFIFVLWKFFSDRIRVEEKYLIEFFSAEYIEYKNKVGVGIPFI
References
External Links
ResourceLink
Saccharomyces Genome Database STE14
Uniprot IDP32584
Uniprot NameSTE14_YEAST
GenBank Gene IDL07952
Genebank Protein ID172018
General Reference
  • Hrycyna, C. A., Sapperstein, S. K., Clarke, S., Michaelis, S. (1991). "The Saccharomyces cerevisiae STE14 gene encodes a methyltransferase that mediates C-terminal methylation of a-factor and RAS proteins." EMBO J 10:1699-1709.2050108
  • Ashby, M. N., Errada, P. R., Boyartchuk, V. L., Rine, J. (1993). "Isolation and DNA sequence of the STE14 gene encoding farnesyl cysteine: carboxyl methyltransferase." Yeast 9:907-913.8212897
  • Sapperstein, S., Berkower, C., Michaelis, S. (1994). "Nucleotide sequence of the yeast STE14 gene, which encodes farnesylcysteine carboxyl methyltransferase, and demonstration of its essential role in a-factor export." Mol Cell Biol 14:1438-1449.8289819
  • Jacq, C., Alt-Morbe, J., Andre, B., Arnold, W., Bahr, A., Ballesta, J. P., Bargues, M., Baron, L., Becker, A., Biteau, N., Blocker, H., Blugeon, C., Boskovic, J., Brandt, P., Bruckner, M., Buitrago, M. J., Coster, F., Delaveau, T., del Rey, F., Dujon, B., Eide, L. G., Garcia-Cantalejo, J. M., Goffeau, A., Gomez-Peris, A., Zaccaria, P., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV." Nature 387:75-78.9169867
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Kim, H., Melen, K., Osterberg, M., von Heijne, G. (2006). "A global topology map of the Saccharomyces cerevisiae membrane proteome." Proc Natl Acad Sci U S A 103:11142-11147.16847258