You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameLysine-specific permease
SynonymsNot Available
Gene NameLYP1
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in transport
Specific FunctionHigh-affinity permease for lysine
Cellular LocationMembrane; Multi-pass membrane protein
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00330L-LysineShow
YMDB00862hydronShow
GO Classification
Component
cell part
membrane
membrane part
intrinsic to membrane
integral to membrane
Function
transporter activity
transmembrane transporter activity
active transmembrane transporter activity
amine transmembrane transporter activity
amino acid transmembrane transporter activity
Process
establishment of localization
transport
amine transport
amino acid transport
transmembrane transport
Gene Properties
Chromosome Locationchromosome 14
LocusYNL268W
Gene Sequence>1836 bp ATGGGCAGGTTTAGTAACATAATAACGTCCAATAAATGGGACGAGAAACAAAACAACATT GGCGAACAGAGCATGCAGGAATTACCAGAAGACCAGATAGAACATGAGATGGAAGCAATA GATCCAAGTAATAAGACGACCCCATACTCTATTGATGAGAAACAGTACAACACAAAAAAG AAGCATGGGTCATTGCAAGGTGGCGCAATCGCTGATGTAAATTCGATAACTAATTCGTTA ACAAGATTGCAAGTTGTCTCTCATGAACCAGATATTGACGAGGATGAAGAAGAAGCCCAC TATGAGGATAAACACGTGAAGAGAGCCTTGAAGCAAAGACACATTGGTATGATTGCACTA GGTGGTACAATCGGTACTGGTCTTTTCGTTGGTATCTCCACTCCCTTGAGTAATGCTGGC CCTGTGGGGTCCCTGATTGCTTACATTTTCATGGGCACCATTGTCTACTTCGTTACCCAG TCACTTGGTGAGATGGCTACGTTTATCCCCGTGACATCATCTATCACTGTCTTTTCGAAG AGGTTCTTATCACCTGCATTCGGTGTTTCTAACGGTTACATGTACTGGTTCAATTGGGCT ATTACTTATGCTGTGGAGGTTTCTGTCATTGGCCAAGTTATTGAATACTGGACAGATAAA GTTCCATTAGCGGCCTGGATTGCGATATTCTGGGTAATTATTACTTTGATGAATTTTTTC CCTGTCAAAGTTTATGGTGAATTTGAGTTCTGGGTGGCCTCTGTTAAAGTTTTAGCCATT ATGGGTTACTTGATATATGCTTTGATTATTGTCTGTGGTGGATCCCACCAGGGCCCTATC GGTTTCAGGTACTGGAGAAATCCAGGAGCCTGGGGGCCAGGCATCATCTCCAGTGATAAA AGTGAAGGCCGTTTTCTCGGATGGGTCTCCTCCTTGATTAATGCTGCATTTACGTACCAA GGTACTGAACTGGTTGGGATCACCGCTGGTGAAGCGGCTAACCCAAGAAAGACCGTTCCA AGAGCTATCAATAAAGTCGTCTTTAGAATCGTACTATTCTATATTATGTCTTTGTTCTTT ATTGGTCTACTGGTTCCATACAACGATTCCCGTTTATCTGCTAGTTCTGCTGTTATTGCA TCATCACCCTTCGTTATTTCCATTCAAAACGCTGGTACTTATGCTCTTCCAGATATTTTC AACGCCGTGGTGTTGATTACTGTTGTATCTGCCGCTAATTCGAATGTTTACGTTGGTTCC CGTGTTCTTTACTCTTTAGCTAGGACTGGTAACGCACCAAAGCAATTTGGATACGTCACC AGACAGGGTGTTCCATATCTCGGTGTTGTTTGCACTGCTGCATTGGGTCTTTTGGCATTC CTGGTTGTCAATAACAATGCAAACACTGCATTTAACTGGTTGATCAACATTTCCACTTTG GCTGGGTTATGCGCCTGGTTATTCATCTCTTTGGCACATATTAGGTTCATGCAAGCTTTA AAGCACCGTGGTATTTCTCGTGATGATCTGCCCTTCAAGGCCAAATTGATGCCTTATGGT GCCTACTACGCAGCCTTTTTTGTCACCGTCATCATATTCATCCAAGGGTTCCAAGCGTTC TGTCCGTTCAAAGTTTCTGAGTTTTTCACATCTTACATCTCCTTGATTCTTTTAGCCGTT ATGTTCATCGGTTGCCAGATATACTACAAATGCAGATTTATTTGGAAGCTAGAAGATATT GACATCGATTCCGACAGAAGAGAAATCGAAGCAATTATCTGGGAAGACGACGAGCCTAAG AATTTATGGGAGAAATTCTGGGCTGCTGTTGCATAA
Protein Properties
Pfam Domain Function
Protein Residues611
Protein Molecular Weight68089.10156
Protein Theoretical pI6.99
Signalling Regions
  • None
Transmembrane Regions
  • 116-136
  • 142-162
  • 186-205
  • 224-243
  • 257-274
  • 304-321
  • 345-365
  • 399-418
  • 446-464
  • 474-494
  • 514-532
  • 548-566
Protein Sequence>Lysine-specific permease MGRFSNIITSNKWDEKQNNIGEQSMQELPEDQIEHEMEAIDPSNKTTPYSIDEKQYNTKK KHGSLQGGAIADVNSITNSLTRLQVVSHETDINEDEEEAHYEDKHVKRALKQRHIGMIAL GGTIGTGLFVGISTPLSNAGPVGSLIAYIFMGTIVYFVTQSLGEMATFIPVTSSITVFSK RFLSPAFGVSNGYMYWFNWAITYAVEVSVIGQVIEYWTDKVPLAAWIAIFWVIITLMNFF PVKVYGEFEFWVASVKVLAIMGYLIYALIIVCGGSHQGPIGFRYWRNPGAWGPGIISSDK SEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRAINKVVFRIVLFYIMSLFF IGLLVPYNDSRLSASSAVIASSPFVISIQNAGTYALPDIFNAVVLITVVSAANSNVYVGS RVLYSLARTGNAPKQFGYVTRQGVPYLGVVCTAALGLLAFLVVNNNANTAFNWLINISTL AGLCAWLFISLAHIRFMQALKHRGISRDDLPFKAKLMPYGAYYAAFFVTVIIFIQGFQAF CPFKVSEFFTSYISLILLAVVFIGCQIYYKCRFIWKLEDIDIDSDRREIEAIIWEDDEPK NLWEKFWAAVA
References
External Links
ResourceLink
Saccharomyces Genome Database LYP1
Uniprot IDP32487
Uniprot NameLYP1_YEAST
GenBank Gene IDX67315
Genebank Protein ID297445
General Reference
  • Sychrova, H., Chevallier, M. R. (1993). "Cloning and sequencing of the Saccharomyces cerevisiae gene LYP1 coding for a lysine-specific permease." Yeast 9:771-782.8368011
  • Sen-Gupta, M., Lyck, R., Fleig, U., Niedenthal, R. K., Hegemann, J. H. (1996). "The sequence of a 24,152 bp segment from the left arm of chromosome XIV from Saccharomyces cerevisiae between the BNI1 and the POL2 genes." Yeast 12:505-514.8740425
  • Philippsen, P., Kleine, K., Pohlmann, R., Dusterhoft, A., Hamberg, K., Hegemann, J. H., Obermaier, B., Urrestarazu, L. A., Aert, R., Albermann, K., Altmann, R., Andre, B., Baladron, V., Ballesta, J. P., Becam, A. M., Beinhauer, J., Boskovic, J., Buitrago, M. J., Bussereau, F., Coster, F., Crouzet, M., D'Angelo, M., Dal Pero, F., De Antoni, A., Del Rey, F., Doignon, F., Domdey, H., Dubois, E., Fiedler, T., Fleig, U., Floeth, M., Fritz, C., Gaillardin, C., Garcia-Cantalejo, J. M., Glansdorff, N. N., Goffeau, A., Gueldener, U., Herbert, C., Heumann, K., Heuss-Neitzel, D., Hilbert, H., Hinni, K., Iraqui Houssaini, I., Jacquet, M., Jimenez, A., Jonniaux, J. L., Karpfinger, L., Lanfranchi, G., Lepingle, A., Levesque, H., Lyck, R., Maftahi, M., Mallet, L., Maurer, K. C., Messenguy, F., Mewes, H. W., Mosti, D., Nasr, F., Nicaud, J. M., Niedenthal, R. K., Pandolfo, D., Pierard, A., Piravandi, E., Planta, R. J., Pohl, T. M., Purnelle, B., Rebischung, C., Remacha, M., Revuelta, J. L., Rinke, M., Saiz, J. E., Sartorello, F., Scherens, B., Sen-Gupta, M., Soler-Mira, A., Urbanus, J. H., Valle, G., Van Dyck, L., Verhasselt, P., Vierendeels, F., Vissers, S., Voet, M., Volckaert, G., Wach, A., Wambutt, R., Wedler, H., Zollner, A., Hani, J. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XIV and its evolutionary implications." Nature 387:93-98.9169873
  • Regenberg, B., During-Olsen, L., Kielland-Brandt, M. C., Holmberg, S. (1999). "Substrate specificity and gene expression of the amino-acid permeases in Saccharomyces cerevisiae." Curr Genet 36:317-328.10654085
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Peng, J., Schwartz, D., Elias, J. E., Thoreen, C. C., Cheng, D., Marsischky, G., Roelofs, J., Finley, D., Gygi, S. P. (2003). "A proteomics approach to understanding protein ubiquitination." Nat Biotechnol 21:921-926.12872131
  • Gruhler, A., Olsen, J. V., Mohammed, S., Mortensen, P., Faergeman, N. J., Mann, M., Jensen, O. N. (2005). "Quantitative phosphoproteomics applied to the yeast pheromone signaling pathway." Mol Cell Proteomics 4:310-327.15665377
  • Kim, H., Melen, K., Osterberg, M., von Heijne, G. (2006). "A global topology map of the Saccharomyces cerevisiae membrane proteome." Proc Natl Acad Sci U S A 103:11142-11147.16847258
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956