You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameGlutamate--cysteine ligase
Synonyms
  • Gamma-ECS
  • GCS
  • Gamma-glutamylcysteine synthetase
Gene NameGSH1
Enzyme Class
Biological Properties
General FunctionInvolved in glutamate-cysteine ligase activity
Specific FunctionATP + L-glutamate + L-cysteine = ADP + phosphate + gamma-L-glutamyl-L-cysteine
Cellular LocationNot Available
SMPDB Pathways
Glutathione metabolismPW002395 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Glutathione metabolismec00480 Map00480
SMPDB Reactions
L-Glutamic acid + L-Cysteine + Adenosine triphosphateADP + phosphate + hydron + Gamma-Glutamylcysteine
KEGG Reactions
Adenosine triphosphate + L-Glutamic acid + L-Cysteinephosphate + Gamma-Glutamylcysteine + hydron + ADP
Metabolites
YMDB IDNameView
YMDB00046L-CysteineShow
YMDB00109Adenosine triphosphateShow
YMDB00252Gamma-GlutamylcysteineShow
YMDB00271L-Glutamic acidShow
YMDB00862hydronShow
YMDB00907phosphateShow
YMDB00914ADPShow
GO Classification
Component
Not Available
Function
ligase activity, forming carbon-nitrogen bonds
acid-amino acid ligase activity
glutamate-cysteine ligase activity
catalytic activity
ligase activity
Process
cellular metabolic process
peptide metabolic process
glutathione metabolic process
glutathione biosynthetic process
metabolic process
Gene Properties
Chromosome Locationchromosome 10
LocusYJL101C
Gene Sequence>2037 bp ATGGGACTCTTAGCTTTGGGCACGCCTTTGCAGTGGTTTGAGTCTAGGACGTACAATGAA CACATAAGGGATGAAGGTATCGAGCAGTTGTTGTATATTTTCCAAGCTGCTGGTAAAAGA GACAATGACCCTCTTTTTTGGGGAGACGAGCTTGAGTACATGGTTGTAGATTTTGATGAT AAGGAGAGAAATTCTATGCTCGACGTTTGCCATGACAAGATACTCACTGAGCTTAATATG GAGGATTCGTCCCTTTGTGAGGCTAACGATGTGAGTTTTCACCCTGAGTATGGCCGGTAT ATGTTAGAGGCAACACCAGCTTCTCCATATTTGAATTACGTGGGTAGTTACGTTGAGGTT AACATGCAAAAAAGACGTGCCATTGCAGAATATAAGCTATCTGAATATGCGAGACAAGAT AGTAAAAATAACTTGCATGTGGGCTCCAGGTCTGTCCCTTTGACGCTGACTGTCTTCCCG AGGATGGGATGCCCCGACTTTATTAACATTAAGGATCCGTGGAATCATAAAAATGCCGCT TCCAGGTCTCTGTTTTTACCCGATGAAGTCATTAACAGACATGTCAGGTTTCCTAACTTG ACAGCATCCATCAGGACCAGGCGTGGTGAAAAAGTTTGCATGAATGTTCCCATGTATAAA GATATAGCTACTCCAGAAACGGATGACTCCATCTACGATCGAGATTGGTTTTTACCAGAA GACAAAGAGGCGAAACTGGCTTCCAAACCGGGTTTCATTTATATGGATTCCATGGGTTTT GGCATGGGCTGTTCGTGCTTACAAGTGACCTTTCAGGCACCCAATATCAACAAGGCACGT TACCTGTACGATGCATTAGTGAATTTTGCACCTATAATGCTAGCCTTCTCTGCCGCTGCG CCTGCTTTTAAAGGTTGGCTAGCCGACCAAGATGTTCGTTGGAATGTGATATCTGGTGCG GTGGACGACCGTACTCCGAAGGAAAGAGGTGTTGCGCCATTACTACCCAAATACAACAAG AACGGATTTGGAGGCATTGCCAAAGACGTACAAGATAAAGTCCTTGAAATACCAAAGTCA AGATATAGTTCGGTTGATCTTTTCTTGGGTGGGTCGAAATTTTTCAATAGGACTTATAAC GACACAAATGTACCTATTAATGAAAAAGTATTAGGACGACTACTAGAGAATGATAAGGCG CCACTGGACTATGATCTTGCTAAACATTTTGCGCATCTCTACATAAGAGATCCAGTATCT ACATTCGAAGAACTGTTGAATCAGGACAACAAAACGTCTTCAAATCACTTTGAAAACATC CAAAGTACAAATTGGCAGACATTACGTTTTAAACCCCCCACACAACAAGCAACCCCGGAC AAAAAGGATTCTCCTGGTTGGAGAGTGGAATTCAGACCATTTGAAGTGCAACTATTAGAT TTTGAGAACGCTGCGTATTCCGTGCTCATATACTTGATTGTCGATAGCATTTTGACCTTT TCCGATAATATTAACGCATATATTCATATGTCCAAAGTATGGGAAAATATGAAGATAGCC CATCACAGAGATGCTATCCTATTTGAAAAATTTCATTGGAAAAAATCATTTCGCAACGAC ACCGATGTGGAAACTGAAGATTATTCTATAAGCGAGATTTTCCATAATCCAGAGAATGGT ATATTTCCTCAATTTGTTACGCCAATCCTATGCCAAAAAGGGTTTGTAACCAAAGATTGG AAAGAATTAAAGCATTCTTCCAAACACGAGAGACTATACTATTATTTAAAGCTAATTTCT GATAGAGCAAGCGGTGAATTGCCAACAACAGCAAAATTCTTTAGAAATTTTGTACTACAA CATCCAGATTACAAACATGATTCAAAAATTTCAAAGTCGATCAATTATGATTTGCTTTCT ACGTGTGATAGACTTACCCATTTAGACGATTCAAAAGGTGAATTGACATCCTTTTTAGGA GCTGAAATTGCAGAATATGTAAAAAAAAATAAGCCTTCAATAGAAAGCAAATGTTAA
Protein Properties
Pfam Domain Function
Protein Residues678
Protein Molecular Weight78252.89844
Protein Theoretical pI6.22
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Glutamate--cysteine ligase MGLLALGTPLQWFESRTYNEHIRDEGIEQLLYIFQAAGKRDNDPLFWGDELEYMVVDFDD KERNSMLDVCHDKILTELNMEDSSLCEANDVSFHPEYGRYMLEATPASPYLNYVGSYVEV NMQKRRAIAEYKLSEYARQDSKNNLHVGSRSVPLTLTVFPRMGCPDFINIKDPWNHKNAA SRSLFLPDEVINRHVRFPNLTASIRTRRGEKVCMNVPMYKDIATPETDDSIYDRDWFLPE DKEAKLASKPGFIYMDSMGFGMGCSCLQVTFQAPNINKARYLYDALVNFAPIMLAFSAAA PAFKGWLADQDVRWNVISGAVDDRTPKERGVAPLLPKYNKNGFGGIAKDVQDKVLEIPKS RYSSVDLFLGGSKFFNRTYNDTNVPINEKVLGRLLENDKAPLDYDLAKHFAHLYIRDPVS TFEELLNQDNKTSSNHFENIQSTNWQTLRFKPPTQQATPDKKDSPGWRVEFRPFEVQLLD FENAAYSVLIYLIVDSILTFSDNINAYIHMSKVWENMKIAHHRDAILFEKFHWKKSFRND TDVETEDYSISEIFHNPENGIFPQFVTPILCQKGFVTKDWKELKHSSKHERLYYYLKLIS DRASGELPTTAKFFRNFVLQHPDYKHDSKISKSINYDLLSTCDRLTHLDDSKGELTSFLG AEIAEYVKKNKPSIESKC
References
External Links
ResourceLink
Saccharomyces Genome Database GSH1
Uniprot IDP32477
Uniprot NameGSH1_YEAST
GenBank Gene IDD90220
Genebank Protein ID218429
General Reference
  • Ohtake, Y., Yabuuchi, S. (1991). "Molecular cloning of the gamma-glutamylcysteine synthetase gene of Saccharomyces cerevisiae." Yeast 7:953-961.1687097
  • Lisowsky, T. (1993). "A high copy number of yeast gamma-glutamylcysteine synthetase suppresses a nuclear mutation affecting mitochondrial translation." Curr Genet 23:408-413.8100487
  • Rasmussen, S. W. (1995). "A 37.5 kb region of yeast chromosome X includes the SME1, MEF2, GSH1 and CSD3 genes, a TCP-1-related gene, an open reading frame similar to the DAL80 gene, and a tRNA(Arg)." Yeast 11:873-883.7483851
  • Galibert, F., Alexandraki, D., Baur, A., Boles, E., Chalwatzis, N., Chuat, J. C., Coster, F., Cziepluch, C., De Haan, M., Domdey, H., Durand, P., Entian, K. D., Gatius, M., Goffeau, A., Grivell, L. A., Hennemann, A., Herbert, C. J., Heumann, K., Hilger, F., Hollenberg, C. P., Huang, M. E., Jacq, C., Jauniaux, J. C., Katsoulou, C., Karpfinger-Hartl, L., et, a. l. .. (1996). "Complete nucleotide sequence of Saccharomyces cerevisiae chromosome X." EMBO J 15:2031-2049.8641269
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956