You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameLow-affinity glucose transporter HXT4
Synonyms
  • Low-affinity glucose transporter LGT1
Gene NameHXT4
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in transmembrane transporter activity
Specific FunctionLow-affinity glucose transporter. Can also transport xylose
Cellular LocationCell membrane (Probable); Multi-pass membrane protein
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00286D-GlucoseShow
YMDB00657D-FructoseShow
YMDB00862hydronShow
YMDB00894D-MannoseShow
GO Classification
Component
membrane part
intrinsic to membrane
integral to membrane
cell part
membrane
Function
transporter activity
transmembrane transporter activity
substrate-specific transmembrane transporter activity
Process
transmembrane transport
establishment of localization
transport
Gene Properties
Chromosome Locationchromosome 8
LocusYHR092C
Gene Sequence>1731 bp ATGTCTGAAGAAGCTGCCTATCAAGAGGATACAGCAGTCCAAAATACTCCAGCTGATGCT TTGTCGCCAGTTGAATCCGATTCTAATTCCGCTTTGTCTACTCCATCCAACAAAGCTGAA AGAGATGACATGAAAGATTTCGACGAGAATCACGAAGAATCTAATAACTACGTTGAAATT CCAAAGAAGCCCGCCTCCGCCTACGTTACAGTTTCCATCTGTTGTTTAATGGTTGCTTTC GGTGGTTTTGTTTTCGGTTGGGATACTGGTACCATTTCTGGTTTTGTTGCTCAAACTGAT TTTATCAGAAGATTTGGTATGAAGCACCACGATGGTACTTATTATTTGTCTAAGGTTAGA ACTGGTTTAATTGTCTCCATTTTCAACATTGGTTGTGCCATTGGTGGTATTATTTTAGCA AAATTAGGTGATATGTATGGTCGTAAAATGGGTTTGATTGTCGTTGTTGTCATCTACATT ATCGGTATCATTATCCAAATTGCCTCAATCAACAAGTGGTACCAATATTTCATTGGTAGA ATTATCTCTGGTTTAGGTGTCGGTGGTATTGCCGTTTTATCTCCTATGTTGATTTCTGAA GTCTCTCCAAAGCATATTAGAGGTACTTTGGTTTCATGTTACCAACTTATGATTACTTTG GGTATTTTCTTGGGTTACTGTACAAACTACGGTACCAAGACCTACACCAATTCTGTCCAA TGGAGAGTTCCATTAGGTCTAGGTTTCGCTTGGGCTTTGTTTATGATTGGTGGTATGACA TTCGTTCCAGAATCTCCACGTTATTTAGTTGAAGTCGGTAAAATTGAAGAAGCTAAGCGT TCTATTGCTCTTTCAAATAAGGTCAGCGCAGACGATCCAGCTGTTATGGCTGAAGTCGAA GTTGTTCAAGCTACAGTTGAAGCTGAAAAATTAGCTGGTAATGCCTCCTGGGGTGAAATA TTTAGCACTAAGACTAAGGTTTTCCAACGTTTGATCATGGGTGCTATGATTCAATCATTG CAACAATTGACAGGTGATAACTATTTCTTCTATTACGGTACTACCGTTTTCACTGCTGTC GGTTTGGAAGATTCTTTTGAAACTTCTATTGTCTTGGGTATTGTCAACTTTGCTTCCACC TTTGTTGGTATTTTCTTAGTCGAAAGATATGGTCGTCGTAGATGTTTATTATGGGGTGCT GCTTCCATGACAGCTTGTATGGTTGTTTTCGCTTCTGTTGGTGTTACAAGATTGTGGCCA AATGGTAAGAAGAACGGGTCTTCTAAGGGTGCTGGTAACTGTATGATTGTCTTCACATGT TTCTACTTATTCTGTTTTGCCACTACCTGGGCTCCAATTCCATTTGTTGTTAACTCTGAA ACTTTCCCATTGAGAGTTAAGTCCAAGTGTATGGCTATTGCTCAAGCTTGTAACTGGATC TGGGGTTTCTTGATTGGTTTCTTTACTCCATTTATTTCAGGTGCTATTGATTTCTACTAC GGTTATGTTTTCATGGGCTGTTTGGTCTTTTCTTACTTCTACGTCTTCTTCTTCGTTCCA GAAACTAAAGGTTTGACTTTAGAAGAAGTTAACACCTTATGGGAAGAAGGTGTTTTGCCA TGGAAATCACCTTCTTGGGTTCCACCAAACAAGAGAGGTACTGACTACAACGCTGATGAT CTAATGCATGATGATCAACCATTTTACAAGAAGATGTTCGGAAAAAAGTAG
Protein Properties
Pfam Domain Function
Protein Residues576
Protein Molecular Weight63909.60156
Protein Theoretical pI6.65
Signalling Regions
  • None
Transmembrane Regions
  • 67-87
  • 123-143
  • 150-170
  • 181-201
  • 208-228
  • 243-263
  • 347-363
  • 370-387
  • 395-415
  • 438-458
  • 476-496
  • 498-518
Protein Sequence>Low-affinity glucose transporter HXT4 MSEEAAYQEDTAVQNTPADALSPVESDSNSALSTPSNKAERDDMKDFDENHEESNNYVEI PKKPASAYVTVSICCLMVAFGGFVFGWDTGTISGFVAQTDFIRRFGMKHHDGTYYLSKVR TGLIVSIFNIGCAIGGIILAKLGDMYGRKMGLIVVVVIYIIGIIIQIASINKWYQYFIGR IISGLGVGGIAVLSPMLISEVSPKHIRGTLVSCYQLMITLGIFLGYCTNYGTKTYTNSVQ WRVPLGLGFAWALFMIGGMTFVPESPRYLVEVGKIEEAKRSIALSNKVSADDPAVMAEVE VVQATVEAEKLAGNASWGEIFSTKTKVFQRLIMGAMIQSLQQLTGDNYFFYYGTTVFTAV GLEDSFETSIVLGIVNFASTFVGIFLVERYGRRRCLLWGAASMTACMVVFASVGVTRLWP NGKKNGSSKGAGNCMIVFTCFYLFCFATTWAPIPFVVNSETFPLRVKSKCMAIAQACNWI WGFLIGFFTPFISGAIDFYYGYVFMGCLVFSYFYVFFFVPETKGLTLEEVNTLWEEGVLP WKSPSWVPPNKRGTDYNADDLMHDDQPFYKKMFGKK
References
External Links
ResourceLink
Saccharomyces Genome Database HXT4
Uniprot IDP32467
Uniprot NameHXT4_YEAST
GenBank Gene IDM81960
Genebank Protein ID171745
General Reference
  • Theodoris, G., Fong, N. M., Coons, D. M., Bisson, L. F. (1994). "High-copy suppression of glucose transport defects by HXT4 and regulatory elements in the promoters of the HXT genes in Saccharomyces cerevisiae." Genetics 137:957-966.7982576
  • Prior, C., Fukuhara, H., Blaisonneau, J., Wesolowski-Louvel, M. (1993). "Low-affinity glucose carrier gene LGT1 of Saccharomyces cerevisiae, a homologue of the Kluyveromyces lactis RAG1 gene." Yeast 9:1373-1377.8154188
  • Johnston, M., Andrews, S., Brinkman, R., Cooper, J., Ding, H., Dover, J., Du, Z., Favello, A., Fulton, L., Gattung, S., et, a. l. .. (1994). "Complete nucleotide sequence of Saccharomyces cerevisiae chromosome VIII." Science 265:2077-2082.8091229
  • Hitchcock, A. L., Auld, K., Gygi, S. P., Silver, P. A. (2003). "A subset of membrane-associated proteins is ubiquitinated in response to mutations in the endoplasmic reticulum degradation machinery." Proc Natl Acad Sci U S A 100:12735-12740.14557538
  • Saloheimo, A., Rauta, J., Stasyk, O. V., Sibirny, A. A., Penttila, M., Ruohonen, L. (2007). "Xylose transport studies with xylose-utilizing Saccharomyces cerevisiae strains expressing heterologous and homologous permeases." Appl Microbiol Biotechnol 74:1041-1052.17180689