You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameLow-affinity glucose transporter HXT3
SynonymsNot Available
Gene NameHXT3
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in transmembrane transporter activity
Specific FunctionLow-affinity glucose transporter
Cellular LocationMembrane; Multi-pass membrane protein
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00286D-GlucoseShow
YMDB00657D-FructoseShow
YMDB00862hydronShow
YMDB00894D-MannoseShow
GO Classification
Component
intrinsic to membrane
integral to membrane
cell part
membrane
membrane part
Function
transporter activity
transmembrane transporter activity
substrate-specific transmembrane transporter activity
Process
transmembrane transport
establishment of localization
transport
Gene Properties
Chromosome Locationchromosome 4
LocusYDR345C
Gene Sequence>1704 bp ATGAATTCAACTCCAGATTTAATATCTCCACAAAAGTCAAGTGAGAATTCGAATGCTGAC CTGCCTTCGAATAGCTCTCAGGTAATGAACATGCCTGAAGAAAAAGGTGTTCAAGATGAT TTCCAAGCTGAGGCCGACCAAGTACTTACCAACCCAAATACAGGTAAAGGTGCATATGTC ACTGTGTCTATCTGTTGTGTTATGGTTGCCTTCGGTGGTTTCGTTTTCGGTTGGGATACT GGTACCATTTCTGGTTTCGTCGCCCAAACTGATTTCTTGAGAAGATTCGGTATGAAGCAT AAAGATGGTAGTTATTATTTGTCTAAGGTTAGAACTGGTTTAATTGTCTCCATTTTCAAC ATTGGTTGTGCCATTGGTGGTATTATTTTGGCTAAATTGGGTGATATGTACGGTCGTAAA ATGGGTTTGATTGTCGTTGTTGTTATCTACATCATCGGTATTATTATTCAAATTGCATCC ATCAACAAATGGTACCAATATTTCATCGGTAGAATTATTTCCGGTTTGGGTGTTGGTGGT ATTGCCGTTTTATCTCCTATGTTGATTTCTGAAGTCGCTCCTAAGGAAATGAGAGGTACT TTAGTCTCCTGTTACCAACTGATGATTACCTTGGGTATTTTCTTGGGTTACTGTACCAAC TTCGGTACTAAGAACTACTCCAACTCTGTGCAATGGAGAGTTCCATTAGGTTTGTGTTTT GCCTGGGCTTTGTTTATGATCGGTGGTATGACTTTCGTTCCAGAATCCCCACGTTATTTG GTTGAAGCTGGTCAAATTGACGAAGCAAGAGCATCTCTTTCCAAAGTTAACAAGGTTGCC CCAGACCATCCATTCATTCAACAAGAGTTGGAAGTTATTGAAGCTAGTGTTGAAGAAGCT AGAGCTGCTGGTTCAGCATCATGGGGTGAGTTGTTCACTGGTAAGCCGGCCATGTTTAAG CGTACTATGATGGGTATCATGATCCAATCTCTACAACAATTGACTGGTGATAACTATTTC TTCTACTATGGTACTACCGTTTTTAACGCTGTTGGTATGAGTGATTCTTTCGAAACTTCT ATTGTTTTCGGTGTCGTCAACTTCTTCTCTACTTGTTGTTCTTTGTACACTGTCGATCGT TTTGGACGTCGTAACTGTTTGTTATATGGTGCCATTGGTATGGTCTGCTGTTATGTAGTT TACGCTTCTGTTGGTGTCACCAGACTATGGCCAAATGGTGAAGGTAATGGTTCATCCAAG GGTGCTGGTAACTGTATGATTGTCTTTGCCTGTTTCTATATTTTCTGTTTTGCTACCACT TGGGCTCCAATTGCTTATGTTGTTATTTCTGAAACTTTCCCATTGAGAGTCAAGTCTAAG GCTATGTCTATTGCTACAGCTGCTAATTGGTTGTGGGGTTTCTTGATTGGTTTCTTCACT CCATTTATTACTGGTGCTATTAACTTCTACTACGGTTACGTTTTCATGGGCTGTATGGTT TTCGCCTACTTCTACGTTTTCTTCTTTGTGCCAGAAACTAAGGGTTTGACTTTGGAAGAA GTCAATGATATGTACGCTGAAGGTGTTCTACCATGGAAGTCTGCTTCATGGGTTCCAACA TCTCAAAGAGGTGCTAACTACGATGCTGATGCATTGATGCATGATGACCAGCCATTCTAC AAGAAAATGTTCGGCAAGAAATAA
Protein Properties
Pfam Domain Function
Protein Residues567
Protein Molecular Weight62557.19922
Protein Theoretical pI7.1
Signalling Regions
  • None
Transmembrane Regions
  • 58-78
  • 114-134
  • 141-161
  • 172-192
  • 199-219
  • 234-254
  • 338-354
  • 361-378
  • 386-406
  • 429-449
  • 467-487
  • 489-509
Protein Sequence>Low-affinity glucose transporter HXT3 MNSTPDLISPQKSSENSNADLPSNSSQVMNMPEEKGVQDDFQAEADQVLTNPNTGKGAYV TVSICCVMVAFGGFVFGWDTGTISGFVAQTDFLRRFGMKHKDGSYYLSKVRTGLIVSIFN IGCAIGGIILAKLGDMYGRKMGLIVVVVIYIIGIIIQIASINKWYQYFIGRIISGLGVGG IAVLSPMLISEVAPKEMRGTLVSCYQLMITLGIFLGYCTNFGTKNYSNSVQWRVPLGLCF AWALFMIGGMTFVPESPRYLVEAGQIDEARASLSKVNKVAPDHPFIQQELEVIEASVEEA RAAGSASWGELFTGKPAMFKRTMMGIMIQSLQQLTGDNYFFYYGTTVFNAVGMSDSFETS IVFGVVNFFSTCCSLYTVDRFGRRNCLLYGAIGMVCCYVVYASVGVTRLWPNGEGNGSSK GAGNCMIVFACFYIFCFATTWAPIAYVVISETFPLRVKSKAMSIATAANWLWGFLIGFFT PFITGAINFYYGYVFMGCMVFAYFYVFFFVPETKGLTLEEVNDMYAEGVLPWKSASWVPT SQRGANYDADALMHDDQPFYKKMFGKK
References
External Links
ResourceLink
Saccharomyces Genome Database HXT3
Uniprot IDP32466
Uniprot NameHXT3_YEAST
GenBank Gene IDL07080
Genebank Protein ID171672
General Reference
  • Ko, C. H., Liang, H., Gaber, R. F. (1993). "Roles of multiple glucose transporters in Saccharomyces cerevisiae." Mol Cell Biol 13:638-648.8417358
  • Jacq, C., Alt-Morbe, J., Andre, B., Arnold, W., Bahr, A., Ballesta, J. P., Bargues, M., Baron, L., Becker, A., Biteau, N., Blocker, H., Blugeon, C., Boskovic, J., Brandt, P., Bruckner, M., Buitrago, M. J., Coster, F., Delaveau, T., del Rey, F., Dujon, B., Eide, L. G., Garcia-Cantalejo, J. M., Goffeau, A., Gomez-Peris, A., Zaccaria, P., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV." Nature 387:75-78.9169867
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Kim, H., Melen, K., Osterberg, M., von Heijne, G. (2006). "A global topology map of the Saccharomyces cerevisiae membrane proteome." Proc Natl Acad Sci U S A 103:11142-11147.16847258
  • Li, X., Gerber, S. A., Rudner, A. D., Beausoleil, S. A., Haas, W., Villen, J., Elias, J. E., Gygi, S. P. (2007). "Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae." J Proteome Res 6:1190-1197.17330950