You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameLow-affinity glucose transporter HXT1
SynonymsNot Available
Gene NameHXT1
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in transmembrane transporter activity
Specific FunctionLow-affinity glucose transporter. HXT1 is as well involved in the transport of mannose
Cellular LocationMembrane; Multi-pass membrane protein
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00286D-GlucoseShow
YMDB00657D-FructoseShow
YMDB00862hydronShow
YMDB00894D-MannoseShow
GO Classification
Component
cell part
membrane
membrane part
intrinsic to membrane
integral to membrane
Function
transmembrane transporter activity
substrate-specific transmembrane transporter activity
transporter activity
Process
transmembrane transport
establishment of localization
transport
Gene Properties
Chromosome Locationchromosome 8
LocusYHR094C
Gene Sequence>1713 bp ATGAATTCAACTCCCGATCTAATATCTCCTCAGAAATCCAATTCATCCAACTCATATGAA TTGGAATCTGGTCGTTCAAAGGCCATGAATACTCCAGAAGGTAAAAATGAAAGTTTTCAC GACAACTTAAGTGAAAGTCAAGTGCAACCCGCCGTTGCCCCTCCAAACACCGGAAAAGGT GTCTACGTAACGGTTTCTATCTGTTGTGTTATGGTTGCTTTCGGTGGTTTCATATTTGGA TGGGATACTGGTACCATTTCTGGTTTTGTTGCTCAAACTGATTTTCTAAGAAGATTTGGT ATGAAGCACCACGACGGTAGTCATTACTTGTCCAAGGTGAGAACTGGTTTAATTGTCTCT ATTTTTAACATTGGTTGTGCCATTGGTGGTATCGTCTTAGCCAAGCTAGGTGATATGTAT GGTCGTAGAATCGGTTTGATTGTCGTTGTAGTAATCTACACTATCGGTATCATTATTCAA ATAGCCTCGATCAACAAGTGGTACCAATATTTCATTGGTAGAATTATCTCTGGTTTAGGT GTCGGTGGTATCACAGTTTTATCTCCCATGCTAATATCTGAGGTCGCCCCCAGTGAAATG AGAGGCACCTTGGTTTCATGTTACCAAGTCATGATTACTTTAGGTATTTTCTTAGGTTAC TGTACCAATTTTGGTACCAAGAATTACTCAAACTCTGTCCAATGGAGAGTTCCATTAGGT TTGTGTTTCGCCTGGGCCTTATTTATGATTGGTGGTATGATGTTTGTTCCTGAATCTCCA CGTTATTTGGTTGAAGCTGGCAGAATCGACGAAGCCAGGGCTTCTTTAGCTAAAGTTAAC AAATGCCCACCTGACCATCCATACATTCAATATGAGTTGGAAACTATCGAAGCCAGTGTC GAAGAAATGAGAGCCGCTGGTACTGCATCTTGGGGCGAATTATTCACTGGTAAACCAGCC ATGTTTCAACGTACTATGATGGGTATCATGATTCAATCTCTACAACAATTAACTGGTGAT AACTATTTCTTCTACTACGGTACCATTGTTTTCCAGGCTGTCGGTTTAAGTGACTCTTTT GAAACTTCTATTGTCTTTGGTGTCGTCAACTTCTTCTCCACTTGTTGTTCTCTGTACACC GTTGACCGTTTTGGCCGTCGTAACTGTTTGATGTGGGGTGCTGTCGGTATGGTCTGCTGT TATGTTGTCTATGCCTCTGTTGGTGTTACCAGATTATGGCCAAACGGTCAAGATCAACCA TCTTCAAAGGGTGCTGGTAACTGTATGATTGTTTTCGCATGTTTCTACATTTTCTGTTTC GCTACTACCTGGGCCCCAATTGCTTACGTTGTTATTTCAGAATGTTTCCCATTAAGAGTC AAATCCAAGTGTATGTCTATTGCCAGTGCTGCTAACTGGATCTGGGGTTTCTTGATTAGT TTCTTCACCCCATTTATTACTGGTGCCATCAACTTCTACTACGGTTACGTTTTCATGGGC TGTATGGTTTTCGCTTACTTTTACGTCTTTTTCTTCGTTCCAGAAACTAAAGGTTTATCA TTAGAAGAAGTTAATGATATGTACGCCGAAGGTGTTCTACCATGGAAATCAGCTTCCTGG GTTCCAGTATCCAAGAGAGGCGCTGACTACAACGCTGATGACCTAATGCATGATGACCAA CCATTTTACAAGAGTTTGTTTAGCAGGAAATAA
Protein Properties
Pfam Domain Function
Protein Residues570
Protein Molecular Weight63260.89844
Protein Theoretical pI7.45
Signalling Regions
  • None
Transmembrane Regions
  • 61-81
  • 117-137
  • 144-164
  • 175-195
  • 202-222
  • 237-257
  • 341-357
  • 364-381
  • 389-409
  • 432-452
  • 470-490
  • 492-512
Protein Sequence>Low-affinity glucose transporter HXT1 MNSTPDLISPQKSNSSNSYELESGRSKAMNTPEGKNESFHDNLSESQVQPAVAPPNTGKG VYVTVSICCVMVAFGGFIFGWDTGTISGFVAQTDFLRRFGMKHHDGSHYLSKVRTGLIVS IFNIGCAIGGIVLAKLGDMYGRRIGLIVVVVIYTIGIIIQIASINKWYQYFIGRIISGLG VGGITVLSPMLISEVAPSEMRGTLVSCYQVMITLGIFLGYCTNFGTKNYSNSVQWRVPLG LCFAWALFMIGGMMFVPESPRYLVEAGRIDEARASLAKVNKCPPDHPYIQYELETIEASV EEMRAAGTASWGELFTGKPAMFQRTMMGIMIQSLQQLTGDNYFFYYGTIVFQAVGLSDSF ETSIVFGVVNFFSTCCSLYTVDRFGRRNCLMWGAVGMVCCYVVYASVGVTRLWPNGQDQP SSKGAGNCMIVFACFYIFCFATTWAPIAYVVISECFPLRVKSKCMSIASAANWIWGFLIS FFTPFITGAINFYYGYVFMGCMVFAYFYVFFFVPETKGLSLEEVNDMYAEGVLPWKSASW VPVSKRGADYNADDLMHDDQPFYKSLFSRK
References
External Links
ResourceLink
Saccharomyces Genome Database HXT1
Uniprot IDP32465
Uniprot NameHXT1_YEAST
GenBank Gene IDL07079
Genebank Protein ID171670
General Reference
  • Lewis, D. A., Bisson, L. F. (1991). "The HXT1 gene product of Saccharomyces cerevisiae is a new member of the family of hexose transporters." Mol Cell Biol 11:3804-3813.2046678
  • Ko, C. H., Liang, H., Gaber, R. F. (1993). "Roles of multiple glucose transporters in Saccharomyces cerevisiae." Mol Cell Biol 13:638-648.8417358
  • Johnston, M., Andrews, S., Brinkman, R., Cooper, J., Ding, H., Dover, J., Du, Z., Favello, A., Fulton, L., Gattung, S., et, a. l. .. (1994). "Complete nucleotide sequence of Saccharomyces cerevisiae chromosome VIII." Science 265:2077-2082.8091229
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Peng, J., Schwartz, D., Elias, J. E., Thoreen, C. C., Cheng, D., Marsischky, G., Roelofs, J., Finley, D., Gygi, S. P. (2003). "A proteomics approach to understanding protein ubiquitination." Nat Biotechnol 21:921-926.12872131
  • Kim, H., Melen, K., Osterberg, M., von Heijne, G. (2006). "A global topology map of the Saccharomyces cerevisiae membrane proteome." Proc Natl Acad Sci U S A 103:11142-11147.16847258
  • Li, X., Gerber, S. A., Rudner, A. D., Beausoleil, S. A., Haas, W., Villen, J., Elias, J. E., Gygi, S. P. (2007). "Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae." J Proteome Res 6:1190-1197.17330950
  • Chi, A., Huttenhower, C., Geer, L. Y., Coon, J. J., Syka, J. E., Bai, D. L., Shabanowitz, J., Burke, D. J., Troyanskaya, O. G., Hunt, D. F. (2007). "Analysis of phosphorylation sites on proteins from Saccharomyces cerevisiae by electron transfer dissociation (ETD) mass spectrometry." Proc Natl Acad Sci U S A 104:2193-2198.17287358
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956