You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameUreidoglycolate hydrolase
SynonymsNot Available
Gene NameDAL3
Enzyme Class
Biological Properties
General FunctionInvolved in ureidoglycolate hydrolase activity
Specific FunctionUtilization of purines as secondary nitrogen sources, when primary sources are limiting
Cellular LocationCell membrane; Lipid-anchor; Cytoplasmic side (Potential)
SMPDB PathwaysNot Available
KEGG Pathways
Purine metabolismec00230 Map00230
SMPDB ReactionsNot Available
KEGG Reactions
water + hydron + Ureidoglycolic acidGlyoxylic acid + Carbon dioxide + Ammonium
Metabolites
YMDB IDNameView
YMDB00033Glyoxylic acidShow
YMDB00091AmmoniaShow
YMDB00377(S)-Ureidoglycolic acidShow
YMDB00423AmmoniumShow
YMDB00862hydronShow
YMDB00890waterShow
YMDB00912Carbon dioxideShow
GO Classification
Component
Not Available
Function
hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds
hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amidines
ureidoglycolate hydrolase activity
catalytic activity
hydrolase activity
Process
amine metabolic process
allantoin metabolic process
allantoin catabolic process
metabolic process
nitrogen compound metabolic process
Gene Properties
Chromosome Locationchromosome 9
LocusYIR032C
Gene Sequence>588 bp ATGGTGACCGTGGTGGCGGAGACATTGACGAAAGAGTCCTTCGAGGAGTATGGGACGATA ATTTCGCCAGATGAAGAGATTTCAAGGATGCAAAACCTTGAAAAAGGTGCAAACCAGGGA ACAGCGATCAAATTGCTTCAAGTAAGCCAGGTAGAGAATAAATCTACCAGTAAAGTTCCC AATTGGAACCTATTCCGTTGCTTTCCACAGCCGCACCTGAATAGAGTATTCACTCAAGGC TCCAATCAGGCGATTTCTCATTCTATCAAAGTCCTCGAAAAGCATCCGTGTAGTACGCAG ACGTTTGTGCCTATGGGGAGAACGTCAGCGGAAGTAGCATACTTGGTAGTAGTCGCTAAA GAAATTGGAAATAAGCCAGACTTGTCTACGTTGAGGGCTTTTACATGTTTGGGTAATCAG GCCGTTACCTATGGCTTAGGTACCTGGCATGCGCCCATGATAGTACTTGGCAAGGAAGAA CATTTGGATTTTTCAGTCTTAATCTACGAAAGTCTGGACCCTGACAGGCCCGAGAAGGAC TGTGTGGAAGAACACTACAGCGATGGCGACGTTTGTATTATCATCTAA
Protein Properties
Pfam Domain Function
Protein Residues195
Protein Molecular Weight21726.59961
Protein Theoretical pI5.06
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Ureidoglycolate hydrolase MVTVVAETLTKESFEEYGTIISPDEEISRMQNLEKGANQGTAIKLLQVSQVENKSTSKVP NWNLFRCFPQPHLNRVFTQGSNQAISHSIKVLEKHPCSTQTFVPMGRTSAEVAYLVVVAK EIGNKPDLSTLRAFTCLGNQAVTYGLGTWHAPMIVLGKEEHLDFSVLIYESLDPDRPEKD CVEEHYSDGDVCIII
References
External Links
ResourceLink
Saccharomyces Genome Database DAL3
Uniprot IDP32459
Uniprot NameALLA_YEAST
GenBank Gene IDM64778
Genebank Protein ID171370
General Reference
  • Yoo, H. S., Cooper, T. G. (1991). "The ureidoglycollate hydrolase (DAL3) gene in Saccharomyces cerevisiae." Yeast 7:693-698.1776360
  • Churcher, C., Bowman, S., Badcock, K., Bankier, A., Brown, D., Chillingworth, T., Connor, R., Devlin, K., Gentles, S., Hamlin, N., Harris, D., Horsnell, T., Hunt, S., Jagels, K., Jones, M., Lye, G., Moule, S., Odell, C., Pearson, D., Rajandream, M., Rice, P., Rowley, N., Skelton, J., Smith, V., Barrell, B., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IX." Nature 387:84-87.9169870