You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NamePutative prephenate dehydratase
Synonyms
  • PDT
  • Phenylalanine-requiring protein 2
Gene NamePHA2
Enzyme Class
Biological Properties
General FunctionInvolved in prephenate dehydratase activity
Specific FunctionPrephenate = phenylpyruvate + H(2)O + CO(2)
Cellular LocationCytoplasm
SMPDB Pathways
Phenylalanine metabolismPW002437 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Phenylalanine metabolismec00360 Map00360
Phenylalanine, tyrosine and tryptophan biosynthesisec00400 Map00400
SMPDB Reactions
Prephenate + hydronwater + Carbon dioxide + keto-phenylpyruvic acid
KEGG Reactions
hydron + PrephenateCarbon dioxide + water + keto-phenylpyruvic acid
Metabolites
YMDB IDNameView
YMDB00324PrephenateShow
YMDB00786keto-phenylpyruvic acidShow
YMDB00862hydronShow
YMDB00890waterShow
YMDB00912Carbon dioxideShow
GO Classification
Component
Not Available
Function
lyase activity
carbon-oxygen lyase activity
hydro-lyase activity
prephenate dehydratase activity
catalytic activity
Process
cellular metabolic process
cellular amino acid and derivative metabolic process
cellular amino acid metabolic process
aromatic amino acid family metabolic process
L-phenylalanine metabolic process
metabolic process
L-phenylalanine biosynthetic process
Gene Properties
Chromosome Locationchromosome 14
LocusYNL316C
Gene Sequence>YNL316C PHA2 SGDID:S000005260, Chr XIV from 43075-42071, reverse complement, Verified ORF, "Prephenate dehydratase, catalyzes the conversion of prephanate to phenylpyruvate, which is a step in the phenylalanine biosynthesis pathway" ATGGCCAGCAAGACTTTGAGGGTTCTTTTTCTGGGTCCCAAAGGTACGTATTCCCATCAA GCTGCATTACAACAATTTCAATCAACATCTGATGTTGAGTACCTCCCAGCAGCCTCTATC CCCCAATGTTTTAACCAATTGGAGAACGACACTAGTATAGATTATTCAGTGGTACCGTTG GAAAATTCCACCAATGGACAAGTAGTTTTTTCCTATGATCTCTTGCGTGATAGGATGATC AAAAAAGCCCTATCCTTACCTGCTCCAGCAGATACTAATAGAATTACACCAGATATAGAA GTTATAGCGGAGCAATATGTACCCATTACCCATTGTCTAATCAGCCCAATCCAACTACCA AATGGTATTGCATCCCTTGGAAATTTTGAAGAAGTCATAATACACTCACATCCGCAAGTA TGGGGCCAGGTTGAATGTTACTTAAGGTCCATGGCAGAAAAATTTCCGCAGGTCACCTTT ATAAGATTGGATTGTTCTTCCACATCTGAATCAGTGAACCAATGCATTCGGTCATCAACG GCCGATTGCGACAACATTCTGCATTTAGCCATTGCTAGTGAAACAGCTGCCCAATTGCAT AAGGCGTACATCATTGAACATTCGATAAATGATAAGCTAGGAAATACAACAAGATTTTTA GTATTGAAGAGAAGGGAGAACGCAGGCGACAATGAAGTAGAAGACACTGGATTACTACGG GTTAACCTACTCACCTTTACTACTCGTCAAGATGACCCTGGTTCTTTGGTAGATGTTTTG AACATACTAAAAATCCATTCACTCAACATGTGTTCTATAAACTCTAGACCATTCCATTTG GACGAACATGATAGAAACTGGCGATATTTATTTTTCATTGAATATTACACCGAGAAGAAT ACCCCAAAGAATAAAGAAAAATTCTATGAAGATATCAGCGACAAAAGTAAACAGTGGTGC CTGTGGGGTACATTCCCCAGAAATGAGAGATATTATCACAAATAA
Protein Properties
Pfam Domain Function
Protein Residues334
Protein Molecular Weight38224.80078
Protein Theoretical pI6.13
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Putative prephenate dehydratase MASKTLRVLFLGPKGTYSHQAALQQFQSTSDVEYLPAASIPQCFNQLENDTSIDYSVVPL ENSTNGQVVFSYDLLRDRMIKKALSLPAPADTNRITPDIEVIAEQYVPITHCLISPIQLP NGIASLGNFEEVIIHSHPQVWGQVECYLRSMAEKFPQVTFIRLDCSSTSESVNQCIRSST ADCDNILHLAIASETAAQLHKAYIIEHSINDKLGNTTRFLVLKRRENAGDNEVEDTGLLR VNLLTFTTRQDDPGSLVDVLNILKIHSLNMCSINSRPFHLDEHDRNWRYLFFIEYYTEKN TPKNKEKFYEDISDKSKQWCLWGTFPRNERYYHK
References
External Links
ResourceLink
Saccharomyces Genome Database PHA2
Uniprot IDP32452
Uniprot NamePHA2_YEAST
General Reference
  • Maftahi, M., Nicaud, J. M., Levesque, H., Gaillardin, C. (1995). "Sequencing analysis of a 24.7 kb fragment of yeast chromosome XIV identifies six known genes, a new member of the hexose transporter family and ten new open reading frames." Yeast 11:1077-1085.7502583
  • Philippsen, P., Kleine, K., Pohlmann, R., Dusterhoft, A., Hamberg, K., Hegemann, J. H., Obermaier, B., Urrestarazu, L. A., Aert, R., Albermann, K., Altmann, R., Andre, B., Baladron, V., Ballesta, J. P., Becam, A. M., Beinhauer, J., Boskovic, J., Buitrago, M. J., Bussereau, F., Coster, F., Crouzet, M., D'Angelo, M., Dal Pero, F., De Antoni, A., Del Rey, F., Doignon, F., Domdey, H., Dubois, E., Fiedler, T., Fleig, U., Floeth, M., Fritz, C., Gaillardin, C., Garcia-Cantalejo, J. M., Glansdorff, N. N., Goffeau, A., Gueldener, U., Herbert, C., Heumann, K., Heuss-Neitzel, D., Hilbert, H., Hinni, K., Iraqui Houssaini, I., Jacquet, M., Jimenez, A., Jonniaux, J. L., Karpfinger, L., Lanfranchi, G., Lepingle, A., Levesque, H., Lyck, R., Maftahi, M., Mallet, L., Maurer, K. C., Messenguy, F., Mewes, H. W., Mosti, D., Nasr, F., Nicaud, J. M., Niedenthal, R. K., Pandolfo, D., Pierard, A., Piravandi, E., Planta, R. J., Pohl, T. M., Purnelle, B., Rebischung, C., Remacha, M., Revuelta, J. L., Rinke, M., Saiz, J. E., Sartorello, F., Scherens, B., Sen-Gupta, M., Soler-Mira, A., Urbanus, J. H., Valle, G., Van Dyck, L., Verhasselt, P., Vierendeels, F., Vissers, S., Voet, M., Volckaert, G., Wach, A., Wambutt, R., Wedler, H., Zollner, A., Hani, J. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XIV and its evolutionary implications." Nature 387:93-98.9169873
  • Ackerman, S. H., Martin, J., Tzagoloff, A. (1992). "Characterization of ATP11 and detection of the encoded protein in mitochondria of Saccharomyces cerevisiae." J Biol Chem 267:7386-7394.1532796
  • Kellis, M., Patterson, N., Endrizzi, M., Birren, B., Lander, E. S. (2003). "Sequencing and comparison of yeast species to identify genes and regulatory elements." Nature 423:241-254.12748633
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106