You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameBiotin synthase, mitochondrial
SynonymsNot Available
Gene NameBIO2
Enzyme Class
Biological Properties
General FunctionInvolved in catalytic activity
Specific FunctionDethiobiotin + sulfur + 2 S-adenosyl-L- methionine = biotin + 2 L-methionine + 2 5'-deoxyadenosine
Cellular LocationMitochondrion
SMPDB Pathways
Biotin BiosynthesisPW002380 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Biotin metabolismec00780 Map00780
SMPDB Reactions
Dethiobiotin + S-Adenosyl-L-methionine + Reduced ferredoxin + a sulfurated [sulfur carrier]  → Biotin + L-Methionine + 5'-Deoxyadenosine + an unsulfurated [sulfur carrier] + Oxidized ferredoxin
KEGG Reactions
polysulfur + DethiobiotinBiotin + hydron
Metabolites
YMDB IDNameView
YMDB00075DethiobiotinShow
YMDB00121SulfideShow
YMDB001505'-DeoxyadenosineShow
YMDB00282BiotinShow
YMDB00297S-AdenosylmethionineShow
YMDB00318L-MethionineShow
YMDB00438S-Adenosyl-L-methionineShow
YMDB00862hydronShow
GO Classification
Component
Not Available
Function
catalytic activity
transferase activity
transferase activity, transferring sulfur-containing groups
sulfurtransferase activity
biotin synthase activity
binding
metal cluster binding
iron-sulfur cluster binding
Process
water-soluble vitamin metabolic process
metabolic process
cellular metabolic process
biotin metabolic process
biotin biosynthetic process
small molecule metabolic process
cofactor metabolic process
vitamin metabolic process
Gene Properties
Chromosome Locationchromosome 7
LocusYGR286C
Gene Sequence>1128 bp ATGATGTCTACTATCTACCGTCATTTATCTACCGCTAGACCGGCTTTAACTAAATACGCA ACCAATGCCGCAGTTAAATCGACAACTGCATCCTCAGAAGCTAGTACTCTGGGTGCTCTA CAATATGCATTGTCTTTAGATGAACCAAGTCATTCGTGGACAAAATCGCAATTAAAAGAA ATTTATCATACCCCACTGCTCGAACTTACTCATGCAGCACAATTGCAGCACAGAAAGTGG CACGATCCAACCAAAGTGCAATTGTGCACATTGATGAACATCAAATCTGGTGGTTGTTCT GAGGACTGTAAGTATTGTGCGCAGTCTTCGAGAAACGATACCGGTCTAAAGGCTGAGAAA ATGGTTAAAGTGGATGAAGTGATTAAAGAGGCAGAAGAGGCCAAAAGAAACGGATCTACT AGATTCTGCCTAGGTGCTGCATGGAGAGACATGAAAGGTCGTAAATCAGCCATGAAAAGA ATTCAGGAAATGGTGACCAAAGTGAATGATATGGGGCTAGAAACGTGTGTTACTTTAGGT ATGGTTGATCAAGATCAAGCAAAGCAATTGAAAGATGCAGGTTTGACTGCATACAACCAT AACATCGACACTTCCAGAGAACACTATAGTAAGGTCATCACCACGAGAACCTACGACGAC AGGTTACAGACCATCAAGAATGTCCAAGAATCTGGAATAAAAGCCTGTACCGGTGGTATT TTGGGTCTCGGTGAAAGCGAAGACGACCATATAGGATTCATCTACACATTATCCAATATG TCTCCTCATCCTGAGTCCCTACCAATTAATAGACTAGTTGCTATCAAAGGGACTCCAATG GCTGAGGAACTTGCCGATCCAAAGAGTAAAAAGTTGCAATTCGACGAAATTTTGAGAACC ATTGCCACAGCGAGAATAGTTATGCCAAAGGCCATTATAAGACTTGCCGCTGGTCGTTAT ACAATGAAAGAAACAGAGCAATTTGTCTGTTTCATGGCAGGTTGTAACAGTATCTTCACC GGTAAGAAAATGCTGACGACAATGTGTAACGGTTGGGACGAAGACAAGGCAATGTTGGCT AAATGGGGATTGCAACCTATGGAGGCATTTAAGTACGACAGATCTTGA
Protein Properties
Pfam Domain Function
Protein Residues375
Protein Molecular Weight41883.80078
Protein Theoretical pI8.66
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Biotin synthase, mitochondrial MMSTIYRHLSTARPALTKYATNAAVKSTTASSEASTLGALQYALSLDEPSHSWTKSQLKE IYHTPLLELTHAAQLQHRKWHDPTKVQLCTLMNIKSGGCSEDCKYCAQSSRNDTGLKAEK MVKVDEVIKEAEEAKRNGSTRFCLGAAWRDMKGRKSAMKRIQEMVTKVNDMGLETCVTLG MVDQDQAKQLKDAGLTAYNHNIDTSREHYSKVITTRTYDDRLQTIKNVQESGIKACTGGI LGLGESEDDHIGFIYTLSNMSPHPESLPINRLVAIKGTPMAEELADPKSKKLQFDEILRT IATARIVMPKAIIRLAAGRYTMKETEQFVCFMAGCNSIFTGKKMLTTMCNGWDEDKAMLA KWGLQPMEAFKYDRS
References
External Links
ResourceLink
Saccharomyces Genome Database BIO2
Uniprot IDP32451
Uniprot NameBIOB_YEAST
GenBank Gene IDZ73071
Genebank Protein ID1323523
General Reference
  • Zhang, S., Sanyal, I., Bulboaca, G. H., Rich, A., Flint, D. H. (1994). "The gene for biotin synthase from Saccharomyces cerevisiae: cloning, sequencing, and complementation of Escherichia coli strains lacking biotin synthase." Arch Biochem Biophys 309:29-35.8117110
  • Volckaert, G., Voet, M., Robben, J. (1997). "Sequence analysis of a near-subtelomeric 35.4 kb DNA segment on the right arm of chromosome VII from Saccharomyces cerevisiae carrying the MAL1 locus reveals 15 complete open reading frames, including ZUO1, BGL2 and BIO2 genes and an ABC transporter gene." Yeast 13:251-259.9090054
  • Tettelin, H., Agostoni Carbone, M. L., Albermann, K., Albers, M., Arroyo, J., Backes, U., Barreiros, T., Bertani, I., Bjourson, A. J., Bruckner, M., Bruschi, C. V., Carignani, G., Castagnoli, L., Cerdan, E., Clemente, M. L., Coblenz, A., Coglievina, M., Coissac, E., Defoor, E., Del Bino, S., Delius, H., Delneri, D., de Wergifosse, P., Dujon, B., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome VII." Nature 387:81-84.9169869
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106