You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NamePhospho-2-dehydro-3-deoxyheptonate aldolase, tyrosine-inhibited
Synonyms
  • 3-deoxy-D-arabino-heptulosonate 7-phosphate synthase
  • DAHP synthase
  • Phospho-2-keto-3-deoxyheptonate aldolase
Gene NameARO4
Enzyme Class
Biological Properties
General FunctionInvolved in catalytic activity
Specific FunctionStereospecific condensation of phosphoenolpyruvate (PEP) and D-erythrose-4-phosphate (E4P) giving rise to 3-deoxy-D- arabino-heptulosonate-7-phosphate (DAHP)
Cellular LocationNot Available
SMPDB PathwaysNot Available
KEGG Pathways
Phenylalanine, tyrosine and tryptophan biosynthesisec00400 Map00400
SMPDB ReactionsNot Available
KEGG Reactions
D-Erythrose 4-phosphate + Phosphoenolpyruvic acid + waterphosphate + 7-phospho-2-dehydro-3-deoxy-D-arabino-heptonic acid
Metabolites
YMDB IDNameView
YMDB000317-phospho-2-dehydro-3-deoxy-D-arabino-heptonic acidShow
YMDB00223D-Erythrose 4-phosphateShow
YMDB00276Phosphoenolpyruvic acidShow
YMDB00890waterShow
YMDB00907phosphateShow
GO Classification
Component
Not Available
Function
transferase activity, transferring alkyl or aryl (other than methyl) groups
catalytic activity
3-deoxy-7-phosphoheptulonate synthase activity
transferase activity
Process
cellular amino acid biosynthetic process
aromatic amino acid family biosynthetic process
metabolic process
biosynthetic process
cellular metabolic process
cellular amino acid and derivative metabolic process
cellular amino acid metabolic process
Gene Properties
Chromosome Locationchromosome 2
LocusYBR249C
Gene Sequence>1113 bp ATGAGTGAATCTCCAATGTTCGCTGCCAACGGCATGCCAAAGGTAAATCAAGGTGCTGAA GAAGATGTCAGAATTTTAGGTTACGACCCATTAGCTTCTCCAGCTCTCCTTCAAGTGCAA ATCCCAGCCACACCAACTTCTTTGGAAACTGCCAAGAGAGGTAGAAGAGAAGCTATAGAT ATTATTACCGGTAAAGACGACAGAGTTCTTGTCATTGTCGGTCCTTGTTCCATCCATGAT CTAGAAGCCGCTCAAGAATACGCTTTGAGATTAAAGAAATTGTCAGATGAATTAAAAGGT GATTTATCCATCATTATGAGAGCATACTTGGAGAAGCCAAGAACAACCGTCGGCTGGAAA GGTCTAATTAATGACCCTGATGTTAACAACACTTTCAACATCAACAAGGGTTTGCAATCC GCTAGACAATTGTTTGTCAACTTGACAAATATCGGTTTGCCAATTGGTTCTGAAATGCTT GATACCATTTCTCCTCAATACTTGGCTGATTTGGTCTCCTTCGGTGCCATTGGTGCCAGA ACCACCGAATCTCAACTGCACAGAGAATTGGCCTCCGGTTTGTCTTTCCCAGTTGGTTTC AAGAACGGTACCGATGGTACCTTAAATGTTGCTGTGGATGCTTGTCAAGCCGCTGCTCAT TCTCACCATTTCATGGGTGTTACTAAGCATGGTGTTGCTGCTATCACCACTACTAAGGGT AACGAACACTGCTTCGTTATTCTAAGAGGTGGTAAAAAGGGTACCAACTACGACGCTAAG TCCGTTGCAGAAGCTAAGGCTCAATTGCCTGCCGGTTCCAACGGTCTAATGATTGACTAC TCTCACGGTAACTCCAATAAGGATTTCAGAAACCAACCAAAGGTCAATGACGTTGTTTGT GAGCAAATCGCTAACGGTGAAAACGCCATTACCGGTGTCATGATTGAATCAAACATCAAC GAAGGTAACCAAGGCATCCCAGCCGAAGGTAAAGCCGGCTTGAAATATGGTGTTTCCATC ACTGATGCTTGTATAGGTTGGGAAACTACTGAAGACGTCTTGAGGAAATTGGCTGCTGCT GTCAGACAAAGAAGAGAAGTTAACAAGAAATAG
Protein Properties
Pfam Domain Function
Protein Residues370
Protein Molecular Weight39748.80078
Protein Theoretical pI6.94
PDB Fileshow
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Phospho-2-dehydro-3-deoxyheptonate aldolase, tyrosine-inhibited MSESPMFAANGMPKVNQGAEEDVRILGYDPLASPALLQVQIPATPTSLETAKRGRREAID IITGKDDRVLVIVGPCSIHDLEAAQEYALRLKKLSDELKGDLSIIMRAYLEKPRTTVGWK GLINDPDVNNTFNINKGLQSARQLFVNLTNIGLPIGSEMLDTISPQYLADLVSFGAIGAR TTESQLHRELASGLSFPVGFKNGTDGTLNVAVDACQAAAHSHHFMGVTKHGVAAITTTKG NEHCFVILRGGKKGTNYDAKSVAEAKAQLPAGSNGLMIDYSHGNSNKDFRNQPKVNDVVC EQIANGENAITGVMIESNINEGNQGIPAEGKAGLKYGVSITDACIGWETTEDVLRKLAAA VRQRREVNKK
References
External Links
ResourceLink
Saccharomyces Genome Database ARO4
Uniprot IDP32449
Uniprot NameAROG_YEAST
GenBank Gene IDX61107
Genebank Protein ID433966
PDB ID
1OF6
General Reference
  • Kunzler, M., Paravicini, G., Egli, C. M., Irniger, S., Braus, G. H. (1992). "Cloning, primary structure and regulation of the ARO4 gene, encoding the tyrosine-inhibited 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase from Saccharomyces cerevisiae." Gene 113:67-74.1348717
  • Doignon, F., Biteau, N., Aigle, M., Crouzet, M. (1993). "The complete sequence of a 6794 bp segment located on the right arm of chromosome II of Saccharomyces cerevisiae. Finding of a putative dUTPase in a yeast." Yeast 9:1131-1137.8256522
  • Feldmann, H., Aigle, M., Aljinovic, G., Andre, B., Baclet, M. C., Barthe, C., Baur, A., Becam, A. M., Biteau, N., Boles, E., Brandt, T., Brendel, M., Bruckner, M., Bussereau, F., Christiansen, C., Contreras, R., Crouzet, M., Cziepluch, C., Demolis, N., Delaveau, T., Doignon, F., Domdey, H., Dusterhus, S., Dubois, E., Dujon, B., El Bakkoury, M., Entian, K. D., Feurmann, M., Fiers, W., Fobo, G. M., Fritz, C., Gassenhuber, H., Glandsdorff, N., Goffeau, A., Grivell, L. A., de Haan, M., Hein, C., Herbert, C. J., Hollenberg, C. P., Holmstrom, K., Jacq, C., Jacquet, M., Jauniaux, J. C., Jonniaux, J. L., Kallesoe, T., Kiesau, P., Kirchrath, L., Kotter, P., Korol, S., Liebl, S., Logghe, M., Lohan, A. J., Louis, E. J., Li, Z. Y., Maat, M. J., Mallet, L., Mannhaupt, G., Messenguy, F., Miosga, T., Molemans, F., Muller, S., Nasr, F., Obermaier, B., Perea, J., Pierard, A., Piravandi, E., Pohl, F. M., Pohl, T. M., Potier, S., Proft, M., Purnelle, B., Ramezani Rad, M., Rieger, M., Rose, M., Schaaff-Gerstenschlager, I., Scherens, B., Schwarzlose, C., Skala, J., Slonimski, P. P., Smits, P. H., Souciet, J. L., Steensma, H. Y., Stucka, R., Urrestarazu, A., van der Aart, Q. J., van Dyck, L., Vassarotti, A., Vetter, I., Vierendeels, F., Vissers, S., Wagner, G., de Wergifosse, P., Wolfe, K. H., Zagulski, M., Zimmermann, F. K., Mewes, H. W., Kleine, K. (1994). "Complete DNA sequence of yeast chromosome II." EMBO J 13:5795-5809.7813418
  • Kuenzler, M., Balmelli, T., Egli, C. M., Paravicini, G., Braus, G. H. (1993). "Cloning, primary structure, and regulation of the HIS7 gene encoding a bifunctional glutamine amidotransferase: cyclase from Saccharomyces cerevisiae." J Bacteriol 175:5548-5558.8366040
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956
  • Hartmann, M., Schneider, T. R., Pfeil, A., Heinrich, G., Lipscomb, W. N., Braus, G. H. (2003). "Evolution of feedback-inhibited beta /alpha barrel isoenzymes by gene duplication and a single mutation." Proc Natl Acad Sci U S A 100:862-867.12540830