You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameMalate dehydrogenase, peroxisomal
SynonymsNot Available
Gene NameMDH3
Enzyme Class
Biological Properties
General FunctionInvolved in oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
Specific Function(S)-malate + NAD(+) = oxaloacetate + NADH
Cellular LocationPeroxisome
SMPDB Pathways
Pyruvate metabolismPW002447 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Citrate cycle (TCA cycle)ec00020 Map00020
Glyoxylate and dicarboxylate metabolismec00630 Map00630
Methane metabolismec00680 Map00680
Pyruvate metabolismec00620 Map00620
SMPDB ReactionsNot Available
KEGG Reactions
NAD + (S)-malate(2-)NADH + hydron + Oxalacetic acid
Metabolites
YMDB IDNameView
YMDB00110NADShow
YMDB00143NADHShow
YMDB00235Oxalacetic acidShow
YMDB00280(S)-Malic acidShow
YMDB00412NAD(+)Show
YMDB00862hydronShow
GO Classification
Component
Not Available
Function
oxidoreductase activity, acting on CH-OH group of donors
oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
catalytic activity
binding
L-malate dehydrogenase activity
malate dehydrogenase activity
oxidoreductase activity
Process
organic acid metabolic process
metabolic process
oxoacid metabolic process
carboxylic acid metabolic process
cellular metabolic process
cellular carbohydrate metabolic process
dicarboxylic acid metabolic process
primary metabolic process
carbohydrate metabolic process
malate metabolic process
oxidation reduction
Gene Properties
Chromosome Locationchromosome 4
LocusYDL078C
Gene Sequence>1032 bp ATGGTCAAAGTCGCAATTCTTGGCGCTTCTGGTGGCGTGGGACAACCGCTATCATTACTG CTAAAATTAAGCCCTTACGTTTCCGAGCTGGCGTTGTACGATATCCGAGCTGCGGAAGGC ATTGGTAAGGATTTATCTCACATCAACACCAACTCAAGTTGTGTCGGTTATGATAAGGAT AGTATTGAGAACACCTTGTCAAATGCTCAGGTGGTGCTAATACCGGCTGGTGTTCCCAGA AAGCCCGGTTTAACTAGAGATGATTTGTTCAAGATGAACGCCGGTATTGTCAAAAGCCTG GTAACCGCTGTTGGAAAGTTCGCACCAAATGCGAGGATTTTAGTCATTTCAAACCCTGTA AACAGTTTGGTCCCTATTGCTGTGGAAACTTTGAAGAAAATGGGTAAGTTCAAACCTGGA AACGTTATGGGTGTGACGAACCTTGACCTGGTACGTGCAGAAACCTTTTTGGTAGATTAT TTGATGCTAAAAAACCCCAAAATTGGACAAGAACAAGACAAAACTACAATGCACAGAAAG GTCACTGTTATTGGGGGTCATTCAGGGGAAACCATTATCCCAATAATCACCGACAAATCG CTGGTATTTCAACTTGATAAGCAGTACGAGCACTTCATTCATAGGGTCCAGTTCGGAGGT GATGAAATTGTCAAAGCTAAACAGGGCGCCGGTTCCGCCACGTTGTCCATGGCGTTCCGG GGGGCCAAGTTTGCTGAAGAAGTTTTGAGGAGCTTCCATAATGAGAAACCAGAAACGGAG TCACTTTCCGCATTCGTTTATTTACCAGGCTTAAAAAACGGTAAGAAAGCGCAGCAATTA GTTGGCGACAACTCTATTGAGTATTTTTCCTTGCCAATTGTTTTGAGAAATGGTAGCGTA GTATCCATCGATACCAGTGTTCTGGAAAAACTGTCTCCGAGAGAGGAACAACTCGTTAAT ACTGCGGTCAAAGAGCTACGCAAGAATATTGAAAAAGGCAAGAGTTTCATCCTAGACTCT TCCAAGCTATGA
Protein Properties
Pfam Domain Function
Protein Residues343
Protein Molecular Weight37185.89844
Protein Theoretical pI9.79
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Malate dehydrogenase, peroxisomal MVKVAILGASGGVGQPLSLLLKLSPYVSELALYDIRAAEGIGKDLSHINTNSSCVGYDKD SIENTLSNAQVVLIPAGVPRKPGLTRDDLFKMNAGIVKSLVTAVGKFAPNARILVISNPV NSLVPIAVETLKKMGKFKPGNVMGVTNLDLVRAETFLVDYLMLKNPKIGQEQDKTTMHRK VTVIGGHSGETIIPIITDKSLVFQLDKQYEHFIHRVQFGGDEIVKAKQGAGSATLSMAFA GAKFAEEVLRSFHNEKPETESLSAFVYLPGLKNGKKAQQLVGDNSIEYFSLPIVLRNGSV VSIDTSVLEKLSPREEQLVNTAVKELRKNIEKGKSFILDSSKL
References
External Links
ResourceLink
Saccharomyces Genome Database MDH3
Uniprot IDP32419
Uniprot NameMDHP_YEAST
GenBank Gene IDM98763
Genebank Protein ID171918
General Reference
  • Steffan, J. S., McAlister-Henn, L. (1992). "Isolation and characterization of the yeast gene encoding the MDH3 isozyme of malate dehydrogenase." J Biol Chem 267:24708-24715.1447211
  • Jacq, C., Alt-Morbe, J., Andre, B., Arnold, W., Bahr, A., Ballesta, J. P., Bargues, M., Baron, L., Becker, A., Biteau, N., Blocker, H., Blugeon, C., Boskovic, J., Brandt, P., Bruckner, M., Buitrago, M. J., Coster, F., Delaveau, T., del Rey, F., Dujon, B., Eide, L. G., Garcia-Cantalejo, J. M., Goffeau, A., Gomez-Peris, A., Zaccaria, P., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV." Nature 387:75-78.9169867
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106