You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameATP-dependent bile acid permease
SynonymsNot Available
Gene NameYBT1
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in ATP binding
Specific FunctionExhibits ATP-dependent bile acid transport
Cellular LocationMembrane; Multi-pass membrane protein (Potential)
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG Reactions
taurocholic acid + Adenosine triphosphate + watertaurocholic acid + phosphate + hydron + ADP
Metabolites
YMDB IDNameView
YMDB00109Adenosine triphosphateShow
YMDB00770taurocholic acidShow
YMDB00862hydronShow
YMDB00890waterShow
YMDB00914ADPShow
GO Classification
Component
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
ATPase activity, coupled to transmembrane movement of substances
purine nucleoside binding
pyrophosphatase activity
adenyl nucleotide binding
nucleoside-triphosphatase activity
adenyl ribonucleotide binding
ATPase activity
ATP binding
nucleotide binding
transporter activity
transmembrane transporter activity
active transmembrane transporter activity
catalytic activity
hydrolase activity
hydrolase activity, acting on acid anhydrides
hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides
primary active transmembrane transporter activity
binding
P-P-bond-hydrolysis-driven transmembrane transporter activity
nucleoside binding
Process
transmembrane transport
establishment of localization
transport
Gene Properties
Chromosome Locationchromosome 12
LocusYLL048C
Gene Sequence>4986 bp ATGCATCACGTACTCAATTCAACGAGACCTGACCATCGGTTTTGGTTTTACGATGACGTA ACTCAGTACGGCAGAACAAAGTACCTTAATTATTATACTCCCTTAGTGCTTTTAATATTC ACGGTGTTGTTCATAACTTATAACATATGGAAACATTATTACTACTATGACGTTCTACAC TTGAAGCAAAAAAATCCAATTGATGAACTTTTATACTCATCTACCGACGAAGACGAACAG AGTCCGTTGATAAATAATAACACCATCACAACTAATTACGTGGACAATAATTGTACAAAA GACGCACTAAAAAATAGACACTTTTCTCTGGAAAAGCTGAAATCAGTTAAGGTAAATGGA GAACCTCATGGTACACCTGAAATAGTTAGAAGAGGCTTCATTGAAAAATCAAGAATTATC CTTGAATTTTTTTTGGTACTTTCTCAAGTTATAATACATTCTTTTATACTATTACACTAT GTCAATAAAAACCCAGAGTTCACCCAACAAGGTACGATTACTGGTTTGGTAGAATGGTGT GCATTGTTTATCATTGTCTCTTTACGTTTAGCAAATGTCAACCAAAATTTCAAATTCATA AACAAATATCCCGGAAATCTATGGTCGGTATCGTTCATAAACTATTTGGCCTTGTTTATC TCTATGATTTTACCCTTTCGTTCCATTTTCATTCACCATATAAACAGTCCTATTTCGAGA AAGTATTACATTTCACAAATATCGATTAACCTTGCCCTTTTCTTGCTACTCTTTTTTGCG AGGATAAGAAATAATTTTGCCATCATCTATAAAACTGACAGCTGGATTACTCCATCTCCA GAACCAGTCACTTCTATTGCTGGATTCATATGCTGGGCTTGGTTAGACAGTTTTGTTTGG AAAGCACACAAAGTTAGTATCAAAGTTAAGGATATTTGGGGATTGATGATGCAAGATTAT TCTTTCTTTGTAGTGAAAAAATTCAGATATTTTGTTGACCATAAGGTTAAAAGGAAGCGT ATTTTTTCACTAAACCTTTTCTTTTTCTTTTCGAATTATTTGGTACTACAATGCTTTTGG GCATTTTTAGGCAGCGTCCTTTCTTTTATTCCAACAGTTTTACTAAAAAGGATCCTGGAA TATGTTGAAGATCAGTCATCTGCTCCCTCAAATTTAGCTTGGTTTTACGTCACTGTCATG TTTGTAGGTAGGATATTAGTGGCTATTTGTCAAGCACAGGCACTATTCTTTGGAAGGAGA GTTTGTATCAGAATGAAAAGTATTATAATCTCTGAGATTTATACTAAAGCTTTGAGAAGA AAGATTTCCACCAACAAGACTAAACCTTCTAATGAGGATCCACAGGAAATTAATGATCAA AAAAGTATCAACGGCGATGAGGAGTCCACTTCTTCTGCCAACCTTGGAGCGATTATTAAT CTCATGGCTATTGACGCTTTCAAGGTTTCTGAAATTTGTGGTTACCTTCATTCATTTTTG GAGGCTTTTGTTATGACTGTTGTCGCACTGGCGCTGTTATACCGTCTGCTGGGTTTTGCT GCGATTGTGGGTGTCTTAATCATTGTCGCAATGCTTCCACTGAATTATAAGCTTGCCAAG TACATCGGCGATTTGCAAAAGAAAAACTTGGCTGTCACAGATAATCGTATTCAAAAGTTG AATGAAGCTTTTCAAGCTATCAGAATCATCAAATACTTTTCATGGGAGGAGAATTTTGAA AAAGATATCAATACTATTAGAGAAAATGAATTATCTCTACTGCTAATGAGATCCATTGTT TGGTCTATCAGTTCCTTTCTTTGGTTTGTTACCCCAACTATTGTAACAGCCGCCTCATTT GCTTACTACATTTACGTTCAAGGCGAGGTATTAACCACTCCGGTTGCCTTTACTGCACTT TCTTTATTCACGTTATTAAGAGATCCTTTGGATCGTTTGTCTGATATGTTAAGTTTTGTC GTTCAATCAAAGGTCTCGTTAGATAGAGTTCAGGATTTCTTAAATGAAAATGATACAAAG AAATACGATCAACTGACCATAGATCCAAATGGAAACAGATTTGCCTTTGAGAATTCCACC ATCTCTTGGGATAAGGACAATCAAGATTTCAAATTGAAAGACTTGAACATTGAATTCAAA ACTGGTAAACTAAATGTCGTTATTGGCCCCACTGGTTCTGGTAAGACATCCCTACTAATG GCATTATTAGGTGAAATGTATCTACTCAATGGTAAGGTTGTCGTCCCAGCTCTAGAACCA AGGCAGGAACTAATAGTAGATGCGAATGGAACCACTAACTCTATCGCTTATTGTTCTCAG GCCGCTTGGCTTCTAAATGATACTGTAAAAAACAACATTTTATTCAATAGTCCATTCAAT GAGGCAAGATATAAAGCTGTTGTCGAAGCATGCGGATTGAAACGTGATTTTGAGATCTTG AAAGCCGGTGACCTAACAGAAATCGGTGAGAAGGGTATTACTTTATCCGGTGGTCAAAAG CAGAGAGTCTCCCTTGCTAGAGCCTTGTATTCCAATGCTAGGCATGTCCTTTTGGATGAT TGTTTAAGTGCAGTTGATTCACATACTGCATCTTGGATTTACGATAATTGTATTACTGGA CCATTAATGGAAGATAGGACATGTATTTTGGTTTCACACAACATCGCCTTGACCTTGAGA AATGCTGAATTGGTAGTCTTACTAGAAGATGGTAGGGTTAAAGACCAAGGTGATCCAATA GACATGTTACAGAAGGGTTTGTTTGGTGAAGACGAGTTAGTGAAAAGTAGTATCTTATCG CGTGCAAACTCTTCTGCTAACTTAGCCGCAAAAAGTAGCACAAGCTTAAGTAACCTACCC GCTGTCAAAGAACAACAAGTTAGCGTGAACAACAACTCCTCCCACTTTGAAGCCAAGAAA CTTCAAAAATCATTGAGGACAGAAGCTGAACGCACTGAAGATGGTAAATTAATAAAAGAG GAAACAAAAGAAGAAGGTGTGGTTGGTCTGGATGTCTATAAATGGTATTTGAAAATTTTT GGTGGTTGGAAGATTGTTTCATTTTTAGCTTCCTTGTTCTTGATAGCCCAACTTTTGTAT ATCGGACAATCATGGTGGGTTCGTGCCTGGGCGTCACACAATGTCATTGCTAAAATTATT CCCAGAGCACAACGCGCTATTGCATTTATCTCCAAGAAGGCTAGTCATCTAATTGATTGG AGGGGCTCGTCCCAAATCAGTATGGCGTCAGCTGAAAACCAACCTTCCAGTGGACACTCT ACAATGTATTATCTGGTTTTGTACCTAATCATTGGTTTTGCTCAGGCTTTATTGGGAGCT GGTAAAACTATTTTAAATTTCGTTGCTGGTATCAACGCGTCAAGAAAGATATTTAATATG ATTCTAAACAAGGTTTTACACTCCAAGATAAGATTTTTTGATGCTACTCCAACAGGTAGA ATTATGAACAGGTTTTCCAAGGATATCGAAGCTATTGATCAGGAACTGACACCTTATATA CAAGGCGCCTTCTATTCGCTTATTGAATGTTTATCCACCGTCATACTGATTACATTTATT ACTCCACAGTTCTTATCTGTTGCTATAGTTGTTTCAATATTGTATTATTTTGTTGGGTAT TTCTACATGGCAGGTTCTCGTGAATTGAAAAGATTTGAATCTATTTCTAGATCACCGATC TATCAACATTTTTCCGAGACTCTTGTCGGTGTTACCACCATTCGTGCGTTTGGTGATGAA GGGAGGTTTATGCAAGAGAATTTACACAAAATTGATGAAAATAATAAACCATTCTTCTAC TTGTGGGTTGCTAATCGTTGGTTGGCCTTTAGGATAGATATGATTGGATCCTTGGTCATT TTTGGAGCTGGTTTGTTCATTCTATTCAATATTAATAATCTGGATTCGGGTATGGCTGGT ATATCTTTGACGTATGCTATTTCCTTCACTGAAGGGGCATTGTGGTTGGTAAGATTGTAC TCTGAAGTGGAGATGAATATGAATTCTGTTGAAAGAGTCAAAGAATATATGGAAATTGAG CAAGAGCCATACAACGAACACAAAGAAATACCGCCACCACAATGGCCACAAGACGGTAAA ATCGAGGTTAATGATTTATCATTACGGTATGCTCCAAATCTACCTAGAGTAATTAAAAAT GTTTCATTTTCTGTCGACGCTCAGTCTAAGATCGGTATTGTTGGTAGAACCGGTGCCGGT AAATCAACTATTATTACCGCCTTGTTCAGATTTTTGGAACCTGAGACAGGCCATATCAAA ATTGATAATATCGATATTTCCGGTGTTGATTTACAAAGACTGCGTCGTTCTATAACTATT ATTCCACAAGATCCAACACTATTCTCAGGGACGATTAAAACAAACCTAGACCCATATGAT GAATTTAGTGACAGACAGATCTTTGAAGCTTTGAAACGTGTAAATCTAATTAGTGAAGAA CAATTACAACAAGGCGCCACAAGAGAAACAAGCAATGAGGCTTCGTCGACTAACTCCGAA AATGTTAATAAATTCTTGGATTTAAGTAGTGAAATTAGCGAAGGTGGATCCAATTTGTCT CAAGGACAGCGCCAATTGATGTGCCTTGCTAGATCTTTACTGAGGAGTCCAAAGATCATA TTGCTGGACGAAGCTACAGCGTCCATCGACTACAGTTCCGATGCGAAGATCCAAGAAACC ATAAGAAAAGAGTTCCAAGGTAGTACAATTTTGACAATTGCACATAGGTTGAGATCTGTT ATCGATTATGATAAAATTTTGGTGATGGATGCAGGTGAGGTAAAAGAGTATGATCACCCA TATTCTTTGTTACTTAACAAACAAAGTGCCTTTTATAGCATGTGTGAGCATAGTGGAGAA TTGGATATCCTAATTGAATTGGCTAAAAAAGCCTTTGTGGAAAAATTGAACTCTAAAAAG GACTAG
Protein Properties
Pfam Domain Function
Protein Residues1661
Protein Molecular Weight189160.0
Protein Theoretical pI8.22
Signalling Regions
  • None
Transmembrane Regions
  • 34-54
  • 75-95
  • 134-154
  • 167-187
  • 206-226
  • 346-366
  • 394-414
  • 496-516
  • 520-540
  • 603-623
  • 645-665
  • 1054-1074
  • 1115-1135
  • 1179-1199
  • 1201-1221
  • 1293-1313
  • 1316-1336
Protein Sequence>ATP-dependent bile acid permease MHHVLNSTRPDHRFWFYDDVTQYGRTKYLNYYTPLVLLIFTVLFITYNIWKHYYYYDVLH LKQKNPIDELLYSSTDEDEQSPLINNNTITTNYVDNNCTKDALKNRHFSLEKLKSVKVNG EPHGTPEIVRRGFIEKSRIILEFFLVLSQVIIHSFILLHYVNKNPEFTQQGTITGLVEWC ALFIIVSLRLANVNQNFKFINKYPGNLWSVSFINYLALFISMILPFRSIFIHHINSPISR KYYISQISINLALFLLLFFARIRNNFAIIYKTDSWITPSPEPVTSIAGFICWAWLDSFVW KAHKVSIKVKDIWGLMMQDYSFFVVKKFRYFVDHKVKRKRIFSLNLFFFFSNYLVLQCFW AFLGSVLSFIPTVLLKRILEYVEDQSSAPSNLAWFYVTVMFVGRILVAICQAQALFFGRR VCIRMKSIIISEIYTKALRRKISTNKTKPSNEDPQEINDQKSINGDEESTSSANLGAIIN LMAIDAFKVSEICGYLHSFLEAFVMTVVALALLYRLLGFAAIVGVLIIVAMLPLNYKLAK YIGDLQKKNLAVTDNRIQKLNEAFQAIRIIKYFSWEENFEKDINTIRENELSLLLMRSIV WSISSFLWFVTPTIVTAASFAYYIYVQGEVLTTPVAFTALSLFTLLRDPLDRLSDMLSFV VQSKVSLDRVQDFLNENDTKKYDQLTIDPNGNRFAFENSTISWDKDNQDFKLKDLNIEFK TGKLNVVIGPTGSGKTSLLMALLGEMYLLNGKVVVPALEPRQELIVDANGTTNSIAYCSQ AAWLLNDTVKNNILFNSPFNEARYKAVVEACGLKRDFEILKAGDLTEIGEKGITLSGGQK QRVSLARALYSNARHVLLDDCLSAVDSHTASWIYDNCITGPLMEDRTCILVSHNIALTLR NAELVVLLEDGRVKDQGDPIDMLQKGLFGEDELVKSSILSRANSSANLAAKSSTSLSNLP AVKEQQVSVNNNSSHFEAKKLQKSLRTEAERTEDGKLIKEETKEEGVVGLDVYKWYLKIF GGWKIVSFLASLFLIAQLLYIGQSWWVRAWASHNVIAKIIPRAQRAIAFISKKASHLIDW RGSSQISMASAENQPSSGHSTMYYLVLYLIIGFAQALLGAGKTILNFVAGINASRKIFNM ILNKVLHSKIRFFDATPTGRIMNRFSKDIEAIDQELTPYIQGAFYSLIECLSTVILITFI TPQFLSVAIVVSILYYFVGYFYMAGSRELKRFESISRSPIYQHFSETLVGVTTIRAFGDE GRFMQENLHKIDENNKPFFYLWVANRWLAFRIDMIGSLVIFGAGLFILFNINNLDSGMAG ISLTYAISFTEGALWLVRLYSEVEMNMNSVERVKEYMEIEQEPYNEHKEIPPPQWPQDGK IEVNDLSLRYAPNLPRVIKNVSFSVDAQSKIGIVGRTGAGKSTIITALFRFLEPETGHIK IDNIDISGVDLQRLRRSITIIPQDPTLFSGTIKTNLDPYDEFSDRQIFEALKRVNLISEE QLQQGATRETSNEASSTNSENVNKFLDLSSEISEGGSNLSQGQRQLMCLARSLLRSPKII LLDEATASIDYSSDAKIQETIRKEFQGSTILTIAHRLRSVIDYDKILVMDAGEVKEYDHP YSLLLNKQSAFYSMCEHSGELDILIELAKKAFVEKLNSKKD
References
External Links
ResourceLink
Saccharomyces Genome Database YBT1
Uniprot IDP32386
Uniprot NameYBT1_YEAST
GenBank Gene IDZ73153
Genebank Protein ID1360247
General Reference
  • Johnston, M., Hillier, L., Riles, L., Albermann, K., Andre, B., Ansorge, W., Benes, V., Bruckner, M., Delius, H., Dubois, E., Dusterhoft, A., Entian, K. D., Floeth, M., Goffeau, A., Hebling, U., Heumann, K., Heuss-Neitzel, D., Hilbert, H., Hilger, F., Kleine, K., Kotter, P., Louis, E. J., Messenguy, F., Mewes, H. W., Hoheisel, J. D., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XII." Nature 387:87-90.9169871
  • Cusick, M. E. (1994). "RNP1, a new ribonucleoprotein gene of the yeast Saccharomyces cerevisiae." Nucleic Acids Res 22:869-877.8139928
  • Ortiz, D. F., St Pierre, M. V., Abdulmessih, A., Arias, I. M. (1997). "A yeast ATP-binding cassette-type protein mediating ATP-dependent bile acid transport." J Biol Chem 272:15358-15365.9182565
  • Ficarro, S. B., McCleland, M. L., Stukenberg, P. T., Burke, D. J., Ross, M. M., Shabanowitz, J., Hunt, D. F., White, F. M. (2002). "Phosphoproteome analysis by mass spectrometry and its application to Saccharomyces cerevisiae." Nat Biotechnol 20:301-305.11875433
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Gruhler, A., Olsen, J. V., Mohammed, S., Mortensen, P., Faergeman, N. J., Mann, M., Jensen, O. N. (2005). "Quantitative phosphoproteomics applied to the yeast pheromone signaling pathway." Mol Cell Proteomics 4:310-327.15665377
  • Li, X., Gerber, S. A., Rudner, A. D., Beausoleil, S. A., Haas, W., Villen, J., Elias, J. E., Gygi, S. P. (2007). "Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae." J Proteome Res 6:1190-1197.17330950
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956