You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
Name1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase 1
Synonyms
  • Phosphoinositide phospholipase C
  • Phospholipase C-1
  • PLC-1
Gene NamePLC1
Enzyme Class
Biological Properties
General FunctionInvolved in protein binding
Specific FunctionThe production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) is mediated by activated phosphatidylinositol-specific phospholipase C enzymes. Required for cell growth, osmoresistance and expression of GPD1
Cellular LocationCytoplasmic
SMPDB Pathways
Inositol MetabolismPW002498 ThumbThumb?image type=greyscaleThumb?image type=simple
Inositol phosphate metabolismPW002495 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Inositol phosphate metabolismec00562 Map00562
SMPDB Reactions
Inositol 1,4,5-trisphosphate + water()-Glycerol 1,2-diacetate + 1-phosphatidyl-1D-myo-inositol 4,5-biphosphate
KEGG Reactions
water + 1D-myo-inositol 4,5-bisphosphateDG(16:0/16:0/0:0) + Inositol 1,4,5-trisphosphate
Metabolites
YMDB IDNameView
YMDB00291Inositol 1,4,5-trisphosphateShow
YMDB00890waterShow
YMDB16247()-Glycerol 1,2-diacetateShow
YMDB162511-phosphatidyl-1D-myo-inositol 4,5-biphosphateShow
GO Classification
Component
Not Available
Function
catalytic activity
binding
lipase activity
phospholipase activity
ion binding
phospholipase C activity
cation binding
phosphoric diester hydrolase activity
metal ion binding
phosphoinositide phospholipase C activity
hydrolase activity
calcium ion binding
hydrolase activity, acting on ester bonds
phosphoric ester hydrolase activity
Process
regulation of biological process
regulation of cellular process
signal transduction
signaling
metabolic process
signaling pathway
intracellular signaling pathway
lipid metabolic process
primary metabolic process
biological regulation
Gene Properties
Chromosome Locationchromosome 16
LocusYPL268W
Gene Sequence>2610 bp ATGACTGAAAGTGCTATAGATGACCAAAGGTTTAATCTTACAAAGGAGTTACAACGACAC TCATGCAGAGATCAAGGGAAAATAACACAAAAGGATGATGCTTTAGATTTTATAAGTTAC AGTTCTTTTCAATCCTCTTTTAATACTGACCAAAAAAGCGCGAACAATGGAAGTACTGTG AGAAGAAGCATAAGGTCGATTTTTAGAAGAGCAGCCGAATTGCCTAGAGTCCATATGGGG CCTCTTACTTATTCACATGGGATAAATGAGCTTGTTAACAAGAAATTAAGAAAAGACTGT GATCTCAGCACGCTATGTCGCGTATTGCAAAGAGGAATCAGGATGATTAGGATGACAAGA AGAAGAAGGAAGTTCTATGAATTTAAATTAATCAATAACAACGGGCAAATAATATGGAAA GATGGTTCGAAGTATCTGGAATTAGACTCCGTTAAAGACATCAGAATCGGTGATACGGCG AGTACTTATCAAGAGGAAGTAGATCCGAAAAGATTGAGATCGGACAGTAAACTTTGGATT GCTATTATTTATAAGGTTTCCAACAAATTGAAAGCGTTACACGTAGTTGCTTTGAATGAA TTGGACTTTAACACATTCTTAAGCTGCATTTGCGGTTTAGTGAAGTTAAGGAGGGAATTA ATGGAAAGCATACTTTTGCCTGATAATTCGCAATTCGCTAGGATACATTGGCAAATTACT GTTTCTGAAAAAGAGGAAGATGAGAAAAAGGACACATTGAGCTTTGCAGATGTGAAGAAA CTATGTGATAAATTTCATATTTATGTGTCAACTGGTCAATTGTTAGAGTTTTTCCAATTA GCAGACATCAATCATAACGGACTATTAAATTATTTTGAATTTGAAAAGTTCATTAAAATC TTAAAGAATAGGAAAGAGGTAAATATGATTTGGTCTAAATTTACAAAACCTCCACACTCC CACTTATCATTTGAAAATTTTTTTCAATTTTTAATTACAGAGCAGCATGAGCAAGTGGAT CGTCAAACTGCATGGTCATATTTTATTAAGTACAGAGAACCGACTCAGCTGACGATGGGG CAAGATGGTTTTACCAAGTTCTTGAAGGAGCAACCATATTTGGTGGAGGTTAAAGAGGAG TTATATTCAAAGCCATTAAACCATTATTTTATTGCATCTTCACATAATACTTATTTATTG GGGAAACAAATTGCAGAAACTCCATCTGTGGAGGGATATATTCAAGTCCTACAACAAGGT TGTAGGTGCGTAGAAATTGATATATGGGATGGTGAAAATGGGCCAGTGGTATGCCATGGA TTTTTAACGTCAGCTATTCCCTTAAAAACAGTTATACGCGTGATAAAGAAGTACGCTTTT ATAACGTCTCCGTATCCTTTGATTATTTCACTGGAAATAAACTGTAACAAGGATAATCAA AAATTGGCAAGCCTGATAATGAGAGAGGTTTTAGCAGAACAGCTGTACTTTGTTGGCACA AGAACTGATAAACTGCCATCACCAAGGGAATTAAAACATAAAATACTGTTGAAATCCAAG AAGACGAGTGAAGCAACTAGAGGTCTTAGCGTTAATGAGCCATTTCCATCTTCTTTTAGT TCTTCTTACGAATCAGCTAATGAACAGGAATTAAGAATGAAAGATGACTCCACGAACAGT AGTAGCGCAACAAATTCTTCTAGTATGCAACGCATCAAAAGAATTGGATTAAAAAAGCAC GCTGATATAATTAATGATGTTTCTAACATTTCTGGAATACATGGCATCAAGTTCAGGAAT TTCTCTTTACCAGAGTCCAAAACGATAGCGCATTGTTTTTCACTGAATGAGCGCAAAGTA GAATACATGATAAAAGACAAACACTTAAAATTATCGTTGGATAAACATAATAGAAGATAT TTGATGAGAGTCTATCCTCACGTTTTACGATACAAATCATCAAATTTTAACCCAATACCT TTTTGGAAGGCCGGTGTACAAATGGTGGCTACGAATTGGCAAACTAATGATATTGGACAG CAACTTAATCTGGCAATGTTTCAAATATTAGATCACCAACCTGATGGAAGTTTTAAATCA GGATACGTGCTAAAACCAAAAAAGTTGCTACCTGTAGTAACAAAGGCGAAAATGATTCCA TTAATTTACGAACATTTTGAAAATGGTAGTGATCCTGTTACTGTTAAAATTCGAATTTTA TCTACACAGTTATTGCCCAGATTGAATGATACATCGCCAAGCAGAAATAACACCAATTCC TTTGTTAAAGTGGAGTTTCATACCGATGACGAGCCGACAATGCCCATCTCAATCGATAAG GGTACAAGGATTTCTGCCACTGAAGCATCCACTAAGAGTTCTCAAGGGAATGGATTCAAC CCAATATGGGATGCTGAAGTTTCTATCACATTGAAAGATACAGACCTCACATTTATAAAA TTCATGGTTATCTCTGAAGAGACCCAGATTGCATCTGTTTGCCTTAAGCTGAACTATTTG AGGATGGGATATCGTCACATTCCGTTGTTTAACATGGAGGGGGAACAATACATATTTTGC ACTTTATTTATTCATACACAAATTTTATAG
Protein Properties
Pfam Domain Function
Protein Residues869
Protein Molecular Weight100547.0
Protein Theoretical pI9.55
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase 1 MTESAIDDQRFNLTKELQRHSCRDQGKITQKDDALDFISYSSFQSSFNTDQKSANNGSTV RRSIRSIFRRAAELPRVHMGPLTYSHGINELVNKKLRKDCDLSTLCRVLQRGIRMIRMTR RRRKFYEFKLINNNGQIIWKDGSKYLELDSVKDIRIGDTASTYQEEVDPKRLRSDSKLWI AIIYKVSNKLKALHVVALNELDFNTFLSCICGLVKLRRELMESILLPDNSQFARIHWQIT VSEKEEDEKKDTLSFADVKKLCDKFHIYVSTGQLLEFFQLADINHNGLLNYFEFEKFIKI LKNRKEVNMIWSKFTKPPHSHLSFENFFQFLITEQHEQVDRQTAWSYFIKYREPTQLTMG QDGFTKFLKEQPYLVEVKEELYSKPLNHYFIASSHNTYLLGKQIAETPSVEGYIQVLQQG CRCVEIDIWDGENGPVVCHGFLTSAIPLKTVIRVIKKYAFITSPYPLIISLEINCNKDNQ KLASLIMREVLAEQLYFVGTRTDKLPSPRELKHKILLKSKKTSEATRGLSVNEPFPSSFS SSYESANEQELRMKDDSTNSSSATNSSSMQRIKRIGLKKHADIINDVSNISGIHGIKFRN FSLPESKTIAHCFSLNERKVEYMIKDKHLKLSLDKHNRRYLMRVYPHVLRYKSSNFNPIP FWKAGVQMVATNWQTNDIGQQLNLAMFQILDHQPDGSFKSGYVLKPKKLLPVVTKAKMIP LIYEHFENGSDPVTVKIRILSTQLLPRLNDTSPSRNNTNSFVKVEFHTDDEPTMPISIDK GTRISATEASTKSSQGNGFNPIWDAEVSITLKDTDLTFIKFMVISEETQIASVCLKLNYL RMGYRHIPLFNMEGEQYIFCTLFIHTQIL
References
External Links
ResourceLink
Saccharomyces Genome Database PLC1
Uniprot IDP32383
Uniprot NamePLC1_YEAST
GenBank Gene IDD12738
Genebank Protein ID287612
General Reference
  • Yoko-o, T., Matsui, Y., Yagisawa, H., Nojima, H., Uno, I., Toh-e, A. (1993). "The putative phosphoinositide-specific phospholipase C gene, PLC1, of the yeast Saccharomyces cerevisiae is important for cell growth." Proc Natl Acad Sci U S A 90:1804-1808.8383328
  • Flick, J. S., Thorner, J. (1993). "Genetic and biochemical characterization of a phosphatidylinositol-specific phospholipase C in Saccharomyces cerevisiae." Mol Cell Biol 13:5861-5876.8395015
  • Payne, W. E., Fitzgerald-Hayes, M. (1993). "A mutation in PLC1, a candidate phosphoinositide-specific phospholipase C gene from Saccharomyces cerevisiae, causes aberrant mitotic chromosome segregation." Mol Cell Biol 13:4351-4364.8391635
  • Bussey, H., Storms, R. K., Ahmed, A., Albermann, K., Allen, E., Ansorge, W., Araujo, R., Aparicio, A., Barrell, B., Badcock, K., Benes, V., Botstein, D., Bowman, S., Bruckner, M., Carpenter, J., Cherry, J. M., Chung, E., Churcher, C., Coster, F., Davis, K., Davis, R. W., Dietrich, F. S., Delius, H., DiPaolo, T., Hani, J., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XVI." Nature 387:103-105.9169875
  • Lin, H., Nguyen, P., Vancura, A. (2002). "Phospholipase C interacts with Sgd1p and is required for expression of GPD1 and osmoresistance in Saccharomyces cerevisiae." Mol Genet Genomics 267:313-320.12073033