You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NamePhosphatidylinositol N-acetylglucosaminyltransferase GPI3 subunit
Synonyms
  • GlcNAc-PI synthesis protein
Gene NameSPT14
Enzyme Class
Biological Properties
General FunctionInvolved in biosynthetic process
Specific FunctionCatalytic subunit in the complex catalyzing the transfer of N-acetylglucosamine from UDP-N-acetylglucosamine to phosphatidylinositol, the first step of GPI biosynthesis
Cellular LocationEndoplasmic reticulum membrane; Single-pass membrane protein (Potential)
SMPDB PathwaysNot Available
KEGG Pathways
Glycosylphosphatidylinositol(GPI)-anchor biosynthesisec00563 Map00563
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB002301-Phosphatidyl-D-myo-inositolShow
YMDB00277Uridine diphosphate-N-acetylglucosamineShow
YMDB00307Uridine 5'-diphosphateShow
GO Classification
Component
Not Available
Function
Not Available
Process
metabolic process
macromolecule metabolic process
macromolecule modification
protein modification process
biosynthetic process
protein amino acid lipidation
GPI anchor biosynthetic process
Gene Properties
Chromosome Locationchromosome 16
LocusYPL175W
Gene Sequence>1359 bp ATGGGCTTCAATATAGCGATGCTGTGCGACTTTTTTTATCCACAGTTAGGTGGAGTCGAA TTCCATATATATCATTTATCGCAGAAACTAATCGATTTGGGCCATTCTGTCGTCATTATA ACTCACGCTTACAAAGATCGAGTCGGCGTACGACATCTTACCAACGGTCTAAAGGTCTAT CACGTACCATTTTTTGTGATTTTCAGAGAAACCACTTTCCCCACTGTTTTTTCAACATTT CCAATAATAAGGAATATTCTTCTCAGAGAGCAGATCCAAATTGTTCATTCTCATGGTAGC GCTTCCACGTTCGCTCACGAGGGAATTCTTCATGCTAATACTATGGGATTGAGAACTGTG TTCACGGACCATTCACTCTACGGTTTTAATAACTTAACGTCGATTTGGGTGAATAAGTTG CTAACATTTACCTTGACAAACATAGATCGGGTTATATGTGTTTCTAATACATGCAAAGAA AATATGATTGTTAGAACAGAATTAAGTCCTGATATAATCTCAGTAATTCCCAACGCAGTG GTGAGCGAAGATTTCAAACCAAGGGATCCTACTGGTGGCACCAAGAGAAAACAAAGTAGG GATAAGATAGTGATCGTGGTCATCGGAAGGCTCTTTCCAAACAAAGGGTCCGATTTACTT ACTCGCATAATTCCGAAAGTTTGTTCCTCACATGAAGATGTCGAATTTATAGTAGCGGGC GATGGTCCAAAGTTCATAGATTTTCAACAAATGATTGAAAGTCATAGACTACAAAAACGT GTGCAACTCTTAGGCTCTGTTCCACATGAGAAAGTCAGGGATGTATTATGTCAAGGTGAC ATATATTTACACGCTAGTTTAACAGAAGCATTTGGTACAATTCTAGTTGAGGCCGCATCT TGTAATTTGCTAATTGTAACGACACAAGTCGGAGGAATTCCCGAAGTGTTACCAAATGAG ATGACTGTTTATGCAGAACAGACATCCGTTTCTGACCTTGTTCAAGCAACAAATAAAGCT ATCAATATCATAAGAAGTAAAGCTTTGGACACTTCCTCTTTTCATGATAGCGTGTCTAAA ATGTACGACTGGATGGACGTAGCCAAAAGGACAGTAGAGATATATACTAATATATCTTCT ACTTCTTCCGCTGATGATAAAGATTGGATGAAAATGGTAGCAAATCTTTACAAAAGAGAT GGAATCTGGGCTAAACATCTTTATCTGTTATGTGGAATTGTAGAGTACATGCTTTTTTTC CTCTTAGAGTGGCTATACCCCAGGGATGAAATCGATCTAGCTCCAAAATGGCCCAAGAAA ACAGTGTCTAACGAGACGAAGGAAGCAAGAGAAACTTAA
Protein Properties
Pfam Domain Function
Protein Residues452
Protein Molecular Weight51241.80078
Protein Theoretical pI7.28
Signalling Regions
  • None
Transmembrane Regions
  • 407-427
Protein Sequence>Phosphatidylinositol N-acetylglucosaminyltransferase GPI3 subunit MGFNIAMLCDFFYPQLGGVEFHIYHLSQKLIDLGHSVVIITHAYKDRVGVRHLTNGLKVY HVPFFVIFRETTFPTVFSTFPIIRNILLREQIQIVHSHGSASTFAHEGILHANTMGLRTV FTDHSLYGFNNLTSIWVNKLLTFTLTNIDRVICVSNTCKENMIVRTELSPDIISVIPNAV VSEDFKPRDPTGGTKRKQSRDKIVIVVIGRLFPNKGSDLLTRIIPKVCSSHEDVEFIVAG DGPKFIDFQQMIESHRLQKRVQLLGSVPHEKVRDVLCQGDIYLHASLTEAFGTILVEAAS CNLLIVTTQVGGIPEVLPNEMTVYAEQTSVSDLVQATNKAINIIRSKALDTSSFHDSVSK MYDWMDVAKRTVEIYTNISSTSSADDKDWMKMVANLYKRDGIWAKHLYLLCGIVEYMLFF LLEWLYPRDEIDLAPKWPKKTVSNETKEARET
References
External Links
ResourceLink
Saccharomyces Genome Database SPT14
Uniprot IDP32363
Uniprot NameGPI3_YEAST
GenBank Gene IDX63290
Genebank Protein ID441475
General Reference
  • Fassler, J. S., Gray, W., Lee, J. P., Yu, G. Y., Gingerich, G. (1991). "The Saccharomyces cerevisiae SPT14 gene is essential for normal expression of the yeast transposon, Ty, as well as for expression of the HIS4 gene and several genes in the mating pathway." Mol Gen Genet 230:310-320.1660567
  • Bussey, H., Storms, R. K., Ahmed, A., Albermann, K., Allen, E., Ansorge, W., Araujo, R., Aparicio, A., Barrell, B., Badcock, K., Benes, V., Botstein, D., Bowman, S., Bruckner, M., Carpenter, J., Cherry, J. M., Chung, E., Churcher, C., Coster, F., Davis, K., Davis, R. W., Dietrich, F. S., Delius, H., DiPaolo, T., Hani, J., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XVI." Nature 387:103-105.9169875
  • Schonbachler, M., Horvath, A., Fassler, J., Riezman, H. (1995). "The yeast spt14 gene is homologous to the human PIG-A gene and is required for GPI anchor synthesis." EMBO J 14:1637-1645.7737116
  • Leidich, S. D., Kostova, Z., Latek, R. R., Costello, L. C., Drapp, D. A., Gray, W., Fassler, J. S., Orlean, P. (1995). "Temperature-sensitive yeast GPI anchoring mutants gpi2 and gpi3 are defective in the synthesis of N-acetylglucosaminyl phosphatidylinositol. Cloning of the GPI2 gene." J Biol Chem 270:13029-13035.7768896
  • Kostova, Z., Rancour, D. M., Menon, A. K., Orlean, P. (2000). "Photoaffinity labelling with P3-(4-azidoanilido)uridine 5'-triphosphate identifies gpi3p as the UDP-GlcNAc-binding subunit of the enzyme that catalyses formation of GlcNAc-phosphatidylinositol, the first glycolipid intermediate in glycosylphosphatidylinositol synthesis." Biochem J 350 Pt 3:815-822.10970797
  • Davis, C. A., Grate, L., Spingola, M., Ares, M. Jr (2000). "Test of intron predictions reveals novel splice sites, alternatively spliced mRNAs and new introns in meiotically regulated genes of yeast." Nucleic Acids Res 28:1700-1706.10734188
  • Kostova, Z., Yan, B. C., Vainauskas, S., Schwartz, R., Menon, A. K., Orlean, P. (2003). "Comparative importance in vivo of conserved glutamate residues in the EX7E motif retaining glycosyltransferase Gpi3p, the UDP-GlcNAc-binding subunit of the first enzyme in glycosylphosphatidylinositol assembly." Eur J Biochem 270:4507-4514.14622279
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Sobering, A. K., Watanabe, R., Romeo, M. J., Yan, B. C., Specht, C. A., Orlean, P., Riezman, H., Levin, D. E. (2004). "Yeast Ras regulates the complex that catalyzes the first step in GPI-anchor biosynthesis at the ER." Cell 117:637-648.15163411