You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameMitochondrial oxaloacetate transport protein
Synonyms
  • Mitochondrial carrier protein PMT
Gene NameOAC1
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in binding
Specific FunctionTransports oxaloacetate and sulfate
Cellular LocationMitochondrion inner membrane; Multi-pass membrane protein (Potential)
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00235Oxalacetic acidShow
YMDB00862hydronShow
GO Classification
Component
organelle membrane
organelle inner membrane
mitochondrial inner membrane
cell part
membrane
Function
binding
transporter activity
Process
transmembrane transport
establishment of localization
transport
Gene Properties
Chromosome Locationchromosome 11
LocusYKL120W
Gene Sequence>975 bp ATGTCATCTGACAACTCTAAACAAGATAAACAAATTGAAAAAACAGCCGCCCAGAAGATA TCGAAGTTTGGTTCGTTTGTGGCTGGTGGGCTAGCAGCATGTATAGCTGTTACAGTTACT AATCCGATCGAATTGATTAAAATCAGAATGCAGCTTCAAGGTGAAATGTCAGCATCAGCT GCAAAAGTTTATAAAAATCCAATCCAAGGTATGGCGGTAATTTTCAAAAACGAAGGTATA AAAGGTCTGCAAAAAGGGTTAAATGCTGCTTATATCTATCAAATTGGGCTAAATGGTTCC AGATTAGGGTTTTATGAGCCAATCAGATCATCATTAAATCAGCTTTTCTTCCCAGATCAA GAGCCACATAAGGTACAGAGCGTCGGAGTTAACGTCTTTTCTGGTGCCGCATCTGGTATA ATTGGTGCAGTCATTGGCTCTCCATTATTCTTGGTGAAAACAAGACTTCAATCATATTCC GAGTTTATAAAAATTGGTGAACAAACGCACTACACCGGTGTTTGGAACGGGTTAGTAACC ATTTTTAAAACCGAAGGTGTTAAGGGTCTATTCAGAGGTATTGATGCGGCAATTTTAAGG ACAGGTGCTGGTTCCTCTGTTCAACTACCTATCTACAACACAGCAAAGAACATTTTGGTC AAAAATGATCTGATGAAAGATGGCCCAGCATTACATTTAACTGCTAGTACTATCTCTGGG TTAGGTGTTGCCGTCGTTATGAACCCATGGGATGTCATTTTGACAAGAATCTATAATCAA AAAGGTGACTTGTACAAGGGACCTATAGATTGTTTGGTCAAAACTGTTAGAATCGAAGGT GTAACCGCTTTGTATAAGGGTTTTGCAGCTCAAGTGTTCAGAATCGCACCTCATACAATC ATGTGTTTGACCTTCATGGAACAGACAATGAAACTAGTTTATTCGATAGAGTCGAGAGTT TTAGGCCATAATTAA
Protein Properties
Pfam Domain Function
Protein Residues324
Protein Molecular Weight35152.80078
Protein Theoretical pI10.07
Signalling Regions
  • None
Transmembrane Regions
  • 26-46
  • 79-99
  • 132-152
  • 193-213
  • 233-253
  • 284-305
Protein Sequence>Mitochondrial oxaloacetate transport protein MSSDNSKQDKQIEKTAAQKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASA AKVYKNPIQGMAVIFKNEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQ EPHKVQSVGVNVFSGAASGIIGAVIGSPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVT IFKTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNILVKNDLMKDGPALHLTASTISG LGVAVVMNPWDVILTRIYNQKGDLYKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAPHTI MCLTFMEQTMKLVYSIESRVLGHN
References
External Links
ResourceLink
Saccharomyces Genome Database OAC1
Uniprot IDP32332
Uniprot NameOAC1_YEAST
GenBank Gene IDAJ238698
Genebank Protein ID5701943
General Reference
  • Palmieri, L., Vozza, A., Agrimi, G., De Marco, V., Runswick, M. J., Palmieri, F., Walker, J. E. (1999). "Identification of the yeast mitochondrial transporter for oxaloacetate and sulfate." J Biol Chem 274:22184-22190.10428783
  • Colleaux, L., Richard, G. F., Thierry, A., Dujon, B. (1992). "Sequence of a segment of yeast chromosome XI identifies a new mitochondrial carrier, a new member of the G protein family, and a protein with the PAAKK motif of the H1 histones." Yeast 8:325-336.1514329
  • Dujon, B., Alexandraki, D., Andre, B., Ansorge, W., Baladron, V., Ballesta, J. P., Banrevi, A., Bolle, P. A., Bolotin-Fukuhara, M., Bossier, P., et, a. l. .. (1994). "Complete DNA sequence of yeast chromosome XI." Nature 369:371-378.8196765
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106