You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameAcetyl-CoA hydrolase
Synonyms
  • Acetyl-CoA deacylase
  • Acetyl-CoA acylase
Gene NameACH1
Enzyme Class
Biological Properties
General FunctionInvolved in catalytic activity
Specific FunctionPresumably involved in regulating the intracellular acetyl-CoA pool for fatty acid and cholesterol synthesis and fatty acid oxidation. It may be involved in overall regulation of acetylation during melatonin synthesis
Cellular LocationCytoplasm
SMPDB Pathways
Pyruvate metabolismPW002447 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Pyruvate metabolismec00620 Map00620
SMPDB Reactions
Acetyl-CoA + waterCoenzyme A + Acetic acid
KEGG Reactions
Acetic acid + hydron + Coenzyme AAcetyl-CoA + water
Acetyl-CoA + waterAcetic acid + hydron + Coenzyme A
Metabolites
YMDB IDNameView
YMDB00045Coenzyme AShow
YMDB00056Acetic acidShow
YMDB00312Acetyl-CoAShow
YMDB00862hydronShow
YMDB00890waterShow
GO Classification
Component
Not Available
Function
catalytic activity
Process
cofactor metabolic process
coenzyme metabolic process
acetyl-CoA metabolic process
metabolic process
cellular metabolic process
Gene Properties
Chromosome Locationchromosome 2
LocusYBL015W
Gene Sequence>1581 bp ATGACAATTTCTAATTTGTTAAAGCAGAGAGTTAGGTATGCTCCCTATCTGAAAAAAGTT AAGGAAGCTCACGAGCTTATTCCATTGTTCAAGAATGGTCAGTACCTTGGGTGGTCCGGT TTTACAGGAGTGGGTACTCCCAAGGCAGTGCCGGAGGCACTGATAGATCACGTGGAGAAG AACAATTTACAAGGGAAGTTGAGATTCAACCTTTTTGTTGGAGCTTCTGCTGGTCCAGAG GAAAACCGTTGGGCTGAACACGACATGATCATTAAGAGAGCCCCTCATCAAGTAGGGAAA CCCATTGCAAAGGCAATTAACCAGGGTAGAATTGAGTTCTTTGATAAACATCTGTCCATG TTCCCTCAGGATCTGACATACGGGTTCTACACCAGGGAAAGAAAAGACAACAAAATCCTT GATTATACTATAATCGAGGCAACGGCCATTAAAGAGGACGGGTCTATCGTCCCAGGTCCC TCTGTCGGTGGTTCTCCAGAATTCATTACAGTCAGTGATAAAGTGATTATTGAGGTTAAC ACGGCTACGCCTTCGTTCGAGGGTATTCACGATATAGACATGCCCGTGAACCCACCTTTC AGGAAACCATACCCATATCTGAAAGTGGACGACAAGTGTGGTGTTGACTCCATCCCGGTT GATCCTGAAAAGGTTGTTGCGATTGTGGAGTCCACCATGAGGGACCAGGTCCCACCAAAT ACGCCCTCTGACGACATGTCCAGGGCTATTGCAGGTCATTTGGTCGAGTTTTTCAGAAAC GAGGTAAAACATGGTAGGCTACCTGAAAACCTGCTGCCTTTACAAAGTGGTATAGGTAAC ATTGCTAACGCTGTCATTGAAGGGCTTGCTGGCGCCCAATTCAAGCACTTGACTGTATGG ACGGAAGTGCTGCAGGACTCGTTATTGGATCTTTTCGAGAACGGATCTTTGGACTACTCC ACTGCTACTTCCGTGAGATTGACTGAAAAGGGTTTCGACAGAGCCTTTGCAAACTGGGAA AATTTCAAACACAGATTGTGTTTGAGATCTCAAGTTGTCTCGAACAATCCGGAAATGATC CGTAGATTCCCTGTCATCGCCATGAATACCCCAGTAGAAGTTGACATTTACGCGCACGCC AATTCTACAAATGTGAATGGTTCCCGTATGTTGAACGGGTTGGGTGGATCTGCTGATTTC TTGAGAAATGCAAAGTTGTCCATCATGCATGCCCCCTCTGCAAGACCAACTAAAGTAGAC CCTACCGGTATCTCTACCATTGTTCCTATGGCCTCTCATGTAGATCAAACTGAGCATGAC CTGGACATCTTGGTCACTGACCAAGGTTTGGCGGATCTAAGAGGTCTATCGCCTAAGGAA AGAGCCCGTGAAATCATCAACAAGTGTGCTCATCCCGATTATCAAGCTTTGTTGACCGAT TACTTGGACAGAGCAGAGCATTACGCTAAAAAGCACAATTGCTTGCATGAACCACACATG CTAAAGAATGCTTTCAAGTTCCACACCAACTTAGCTGAAAAGGGTACAATGAAGGTCGAC AGCTGGGAACCAGTTGACTAG
Protein Properties
Pfam Domain Function
Protein Residues526
Protein Molecular Weight58711.5
Protein Theoretical pI6.77
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Acetyl-CoA hydrolase MTISNLLKQRVRYAPYLKKVKEAHELIPLFKNGQYLGWSGFTGVGTPKAVPEALIDHVEK NNLQGKLRFNLFVGASAGPEENRWAEHDMIIKRAPHQVGKPIAKAINQGRIEFFDKHLSM FPQDLTYGFYTRERKDNKILDYTIIEATAIKEDGSIVPGPSVGGSPEFITVSDKVIIEVN TATPSFEGIHDIDMPVNPPFRKPYPYLKVDDKCGVDSIPVDPEKVVAIVESTMRDQVPPN TPSDDMSRAIAGHLVEFFRNEVKHGRLPENLLPLQSGIGNIANAVIEGLAGAQFKHLTVW TEVLQDSFLDLFENGSLDYATATSVRLTEKGFDRAFANWENFKHRLCLRSQVVSNNPEMI RRLGVIAMNTPVEVDIYAHANSTNVNGSRMLNGLGGSADFLRNAKLSIMHAPSARPTKVD PTGISTIVPMASHVDQTEHDLDILVTDQGLADLRGLSPKERAREIINKCAHPDYQALLTD YLDRAEHYAKKHNCLHEPHMLKNAFKFHTNLAEKGTMKVDSWEPVD
References
External Links
ResourceLink
Saccharomyces Genome Database ACH1
Uniprot IDP32316
Uniprot NameACH1_YEAST
GenBank Gene IDM31036
Genebank Protein ID170980
General Reference
  • Lee, F. J., Lin, L. W., Smith, J. A. (1990). "A glucose-repressible gene encodes acetyl-CoA hydrolase from Saccharomyces cerevisiae." J Biol Chem 265:7413-7418.1970569
  • Van Dyck, L., Purnelle, B., Skala, J., Goffeau, A. (1992). "An 11.4 kb DNA segment on the left arm of yeast chromosome II carries the carboxypeptidase Y sorting gene PEP1, as well as ACH1, FUS3 and a putative ARS." Yeast 8:769-776.1441754
  • Feldmann, H., Aigle, M., Aljinovic, G., Andre, B., Baclet, M. C., Barthe, C., Baur, A., Becam, A. M., Biteau, N., Boles, E., Brandt, T., Brendel, M., Bruckner, M., Bussereau, F., Christiansen, C., Contreras, R., Crouzet, M., Cziepluch, C., Demolis, N., Delaveau, T., Doignon, F., Domdey, H., Dusterhus, S., Dubois, E., Dujon, B., El Bakkoury, M., Entian, K. D., Feurmann, M., Fiers, W., Fobo, G. M., Fritz, C., Gassenhuber, H., Glandsdorff, N., Goffeau, A., Grivell, L. A., de Haan, M., Hein, C., Herbert, C. J., Hollenberg, C. P., Holmstrom, K., Jacq, C., Jacquet, M., Jauniaux, J. C., Jonniaux, J. L., Kallesoe, T., Kiesau, P., Kirchrath, L., Kotter, P., Korol, S., Liebl, S., Logghe, M., Lohan, A. J., Louis, E. J., Li, Z. Y., Maat, M. J., Mallet, L., Mannhaupt, G., Messenguy, F., Miosga, T., Molemans, F., Muller, S., Nasr, F., Obermaier, B., Perea, J., Pierard, A., Piravandi, E., Pohl, F. M., Pohl, T. M., Potier, S., Proft, M., Purnelle, B., Ramezani Rad, M., Rieger, M., Rose, M., Schaaff-Gerstenschlager, I., Scherens, B., Schwarzlose, C., Skala, J., Slonimski, P. P., Smits, P. H., Souciet, J. L., Steensma, H. Y., Stucka, R., Urrestarazu, A., van der Aart, Q. J., van Dyck, L., Vassarotti, A., Vetter, I., Vierendeels, F., Vissers, S., Wagner, G., de Wergifosse, P., Wolfe, K. H., Zagulski, M., Zimmermann, F. K., Mewes, H. W., Kleine, K. (1994). "Complete DNA sequence of yeast chromosome II." EMBO J 13:5795-5809.7813418
  • Grandier-Vazeille, X., Bathany, K., Chaignepain, S., Camougrand, N., Manon, S., Schmitter, J. M. (2001). "Yeast mitochondrial dehydrogenases are associated in a supramolecular complex." Biochemistry 40:9758-9769.11502169
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Reinders, J., Wagner, K., Zahedi, R. P., Stojanovski, D., Eyrich, B., van der Laan, M., Rehling, P., Sickmann, A., Pfanner, N., Meisinger, C. (2007). "Profiling phosphoproteins of yeast mitochondria reveals a role of phosphorylation in assembly of the ATP synthase." Mol Cell Proteomics 6:1896-1906.17761666