You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameGlycerol kinase
Synonyms
  • GK
  • Glycerokinase
  • ATP:glycerol 3-phosphotransferase
Gene NameGUT1
Enzyme Class
Biological Properties
General FunctionInvolved in phosphotransferase activity, alcohol group as acceptor
Specific FunctionATP + glycerol = ADP + sn-glycerol 3- phosphate
Cellular LocationNot Available
SMPDB Pathways
Glycerol metabolismPW002407 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Glycerolipid metabolismec00561 Map00561
SMPDB Reactions
Glycerol + Adenosine triphosphateADP + Glycerol 3-phosphate
KEGG Reactions
Adenosine triphosphate + GlycerolGlycerol 3-phosphate + hydron + ADP
Metabolites
YMDB IDNameView
YMDB00073Glycerol 3-phosphateShow
YMDB00109Adenosine triphosphateShow
YMDB00283GlycerolShow
YMDB00862hydronShow
YMDB00914ADPShow
GO Classification
Component
Not Available
Function
transferase activity, transferring phosphorus-containing groups
glycerol kinase activity
kinase activity
phosphotransferase activity, alcohol group as acceptor
catalytic activity
transferase activity
Process
metabolic process
glycerol metabolic process
glycerol-3-phosphate metabolic process
primary metabolic process
carbohydrate metabolic process
small molecule metabolic process
alcohol metabolic process
polyol metabolic process
alditol metabolic process
Gene Properties
Chromosome Locationchromosome 8
LocusYHL032C
Gene Sequence>2130 bp ATGTTTCCCTCTCTCTTCCGACTTGTAGTATTCTCCAAACGTTACATATTCCGATCAAGC CAGCGCCTTTACACTAGTTTAAAACAAGAACAGAGCCGTATGTCCAAAATAATGGAAGAT TTACGAAGTGACTACGTCCCGCTTATCGCCAGTATTGATGTAGGAACGACCTCATCCAGA TGCATTCTGTTCAACAGATGGGGCCAGGACGTTTCAAAACACCAAATTGAATATTCAACT TCAGCATCGAAGGGCAAGATTGGGGTGTCTGGCCTAAGGAGACCCTCTACAGCCCCAGCT CGTGAAACACCAAACGCCGGTGACATCAAAACCAGCGGAAAGCCCATCTTTTCTGCAGAA GGCTATGCCATTCAAGAAACCAAATTCCTAAAAATCGAGGAATTGGACTTGGACTTCCAT AACGAACCCACGTTGAAGTTCCCCAAACCGGGTTGGGTTGAGTGCCATCCGCAGAAATTA CTGGTGAACGTCGTCCAATGCCTTGCCTCAAGTTTGCTCTCTCTGCAGACTATCAACAGC GAACGTGTAGCAAACGGTCTCCCACCTTACAAGGTAATATGCATGGGTATAGCAAACATG AGAGAAACCACAATTCTGTGGTCCCGCCGCACAGGAAAACCAATTGTTAACTACGGTATT GTTTGGAACGACACCAGAACGATCAAAATCGTTAGAGACAAATGGCAAAACACTAGCGTC GATAGGCAACTGCAGCTTAGACAGAAGACTGGATTGCCATTGCTCTCCACGTATTTCTCC TGTTCCAAGCTGCGCTGGTTCCTCGACAATGAGCCTCTGTGTACCAAGGCGTATGAGGAG AACGACCTGATGTTCGGCACTGTGGACACATGGCTGATTTACCAATTAACTAAACAAAAG GCGTTCGTTTCTGACGTAACCAACGCTTCCAGAACTGGATTTATGAACCTCTCCACTTTA AAGTACGACAACGAGTTGCTGGAATTTTGGGGTATTGACAAGAACCTGATTCACATGCCC GAAATTGTGTCCTCATCTCAATACTACGGTGACTTTGGCATTCCTGATTGGATAATGGAA AAGCTACACGATTCGCCAAAAACAGTACTGCGAGATCTAGTCAAGAGAAACCTGCCCATA CAGGGCTGTCTGGGCGACCAAAGCGCATCCATGGTGGGGCAACTCGCTTACAAACCCGGT GCTGCAAAATGTACTTATGGTACCGGTTGCTTTTTACTGTACAATACGGGGACCAAAAAA TTGATCTCCCAACATGGCGCACTGACGACTCTAGCATTTTGGTTCCCACATTTGCAAGAG TACGGTGGCCAAAAACCAGAATTGAGCAAGCCACATTTTGCATTAGAGGGTTCCGTCGCT GTGGCTGGTGCTGTGGTCCAATGGCTACGTGATAATTTACGATTGATCGATAAATCAGAG GATGTCGGACCGATTGCATCTACGGTTCCTGATTCTGGTGGCGTAGTTTTCGTCCCCGCA TTTAGTGGCCTATTCGCTCCCTATTGGGACCCAGATGCCAGAGCCACCATAATGGGGATG TCTCAATTCACTACTGCCTCCCACATCGCCAGAGCTGCCGTGGAAGGTGTTTGCTTTCAA GCCAGGGCTATCTTGAAGGCAATGAGTTCTGACGCGTTTGGTGAAGGTTCCAAAGACAGG GACTTTTTAGAGGAAATTTCCGACGTCACATATGAAAAGTCGCCCCTGTCGGTTCTGGCA GTGGATGGCGGGATGTCGAGGTCTAATGAAGTCATGCAAATTCAAGCCGATATCTTAGGT CCCTGTGTCAAAGTCAGAAGGTCTCCGACAGCGGAATGTACCGCATTGGGGGCAGCCATT GCAGCCAATATGGCTTTCAAGGATGTGAACGAGCGCCCATTATGGAAGGACCTACACGAT GTTAAGAAATGGGTCTTTTACAATGGAATGGAGAAAAACGAACAAATATCACCAGAGGCT CATCCAAACCTTAAGATATTCAGAAGTGAATCCGACGATGCTGAAAGGAGAAAGCATTGG AAGTATTGGGAAGTTGCCGTGGAAAGATCCAAAGGTTGGCTGAAGGACATAGAAGGTGAA CACGAACAGGTTCTAGAAAACTTCCAATAA
Protein Properties
Pfam Domain Function
Protein Residues709
Protein Molecular Weight79823.60156
Protein Theoretical pI8.15
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Glycerol kinase MFPSLFRLVVFSKRYIFRSSQRLYTSLKQEQSRMSKIMEDLRSDYVPLIASIDVGTTSSR CILFNRWGQDVSKHQIEYSTSASKGKIGVSGLRRPSTAPARETPNAGDIKTSGKPIFSAE GYAIQETKFLKIEELDLDFHNEPTLKFPKPGWVECHPQKLLVNVVQCLASSLLSLQTINS ERVANGLPPYKVICMGIANMRETTILWSRRTGKPIVNYGIVWNDTRTIKIVRDKWQNTSV DRQLQLRQKTGLPLLSTYFSCSKLRWFLDNEPLCTKAYEENDLMFGTVDTWLIYQLTKQK AFVSDVTNASRTGFMNLSTLKYDNELLEFWGIDKNLIHMPEIVSSSQYYGDFGIPDWIME KLHDSPKTVLRDLVKRNLPIQGCLGDQSASMVGQLAYKPGAAKCTYGTGCFLLYNTGTKK LISQHGALTTLAFWFPHLQEYGGQKPELSKPHFALEGSVAVAGAVVQWLRDNLRLIDKSE DVGPIASTVPDSGGVVFVPAFSGLFAPYWDPDARATIMGMSQFTTASHIARAAVEGVCFQ ARAILKAMSSDAFGEGSKDRDFLEEISDVTYEKSPLSVLAVDGGMSRSNEVMQIQADILG PCVKVRRSPTAECTALGAAIAANMAFKDVNERPLWKDLHDVKKWVFYNGMEKNEQISPEA HPNLKIFRSESDDAERRKHWKYWEVAVERSKGWLKDIEGEHEQVLENFQ
References
External Links
ResourceLink
Saccharomyces Genome Database GUT1
Uniprot IDP32190
Uniprot NameGLPK_YEAST
GenBank Gene IDU11583
Genebank Protein ID2289861
General Reference
  • Pavlik, P., Simon, M., Schuster, T., Ruis, H. (1993). "The glycerol kinase (GUT1) gene of Saccharomyces cerevisiae: cloning and characterization." Curr Genet 24:21-25.8358828
  • Johnston, M., Andrews, S., Brinkman, R., Cooper, J., Ding, H., Dover, J., Du, Z., Favello, A., Fulton, L., Gattung, S., et, a. l. .. (1994). "Complete nucleotide sequence of Saccharomyces cerevisiae chromosome VIII." Science 265:2077-2082.8091229
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356