You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameGlycerol kinase
Synonyms
  • GK
  • Glycerokinase
  • ATP:glycerol 3-phosphotransferase
Gene NameGUT1
Enzyme Class
Biological Properties
General FunctionInvolved in phosphotransferase activity, alcohol group as acceptor
Specific FunctionATP + glycerol = ADP + sn-glycerol 3- phosphate
Cellular LocationNot Available
SMPDB Pathways
Glycerol metabolismPW002407 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Glycerolipid metabolismec00561 Map00561
SMPDB Reactions
Glycerol + Adenosine triphosphateADP + Glycerol 3-phosphate
KEGG Reactions
Adenosine triphosphate + GlycerolGlycerol 3-phosphate + hydron + ADP
Metabolites
YMDB IDNameView
YMDB00073Glycerol 3-phosphateShow
YMDB00109Adenosine triphosphateShow
YMDB00283GlycerolShow
YMDB00862hydronShow
YMDB00914ADPShow
GO Classification
Component
Not Available
Function
transferase activity, transferring phosphorus-containing groups
kinase activity
phosphotransferase activity, alcohol group as acceptor
glycerol kinase activity
catalytic activity
transferase activity
Process
primary metabolic process
carbohydrate metabolic process
small molecule metabolic process
alcohol metabolic process
polyol metabolic process
alditol metabolic process
glycerol metabolic process
glycerol-3-phosphate metabolic process
metabolic process
Gene Properties
Chromosome Locationchromosome 8
LocusYHL032C
Gene Sequence>2130 bp ATGTTTCCCTCTCTCTTCCGACTTGTAGTATTCTCCAAACGTTACATATTCCGATCAAGC CAGCGCCTTTACACTAGTTTAAAACAAGAACAGAGCCGTATGTCCAAAATAATGGAAGAT TTACGAAGTGACTACGTCCCGCTTATCGCCAGTATTGATGTAGGAACGACCTCATCCAGA TGCATTCTGTTCAACAGATGGGGCCAGGACGTTTCAAAACACCAAATTGAATATTCAACT TCAGCATCGAAGGGCAAGATTGGGGTGTCTGGCCTAAGGAGACCCTCTACAGCCCCAGCT CGTGAAACACCAAACGCCGGTGACATCAAAACCAGCGGAAAGCCCATCTTTTCTGCAGAA GGCTATGCCATTCAAGAAACCAAATTCCTAAAAATCGAGGAATTGGACTTGGACTTCCAT AACGAACCCACGTTGAAGTTCCCCAAACCGGGTTGGGTTGAGTGCCATCCGCAGAAATTA CTGGTGAACGTCGTCCAATGCCTTGCCTCAAGTTTGCTCTCTCTGCAGACTATCAACAGC GAACGTGTAGCAAACGGTCTCCCACCTTACAAGGTAATATGCATGGGTATAGCAAACATG AGAGAAACCACAATTCTGTGGTCCCGCCGCACAGGAAAACCAATTGTTAACTACGGTATT GTTTGGAACGACACCAGAACGATCAAAATCGTTAGAGACAAATGGCAAAACACTAGCGTC GATAGGCAACTGCAGCTTAGACAGAAGACTGGATTGCCATTGCTCTCCACGTATTTCTCC TGTTCCAAGCTGCGCTGGTTCCTCGACAATGAGCCTCTGTGTACCAAGGCGTATGAGGAG AACGACCTGATGTTCGGCACTGTGGACACATGGCTGATTTACCAATTAACTAAACAAAAG GCGTTCGTTTCTGACGTAACCAACGCTTCCAGAACTGGATTTATGAACCTCTCCACTTTA AAGTACGACAACGAGTTGCTGGAATTTTGGGGTATTGACAAGAACCTGATTCACATGCCC GAAATTGTGTCCTCATCTCAATACTACGGTGACTTTGGCATTCCTGATTGGATAATGGAA AAGCTACACGATTCGCCAAAAACAGTACTGCGAGATCTAGTCAAGAGAAACCTGCCCATA CAGGGCTGTCTGGGCGACCAAAGCGCATCCATGGTGGGGCAACTCGCTTACAAACCCGGT GCTGCAAAATGTACTTATGGTACCGGTTGCTTTTTACTGTACAATACGGGGACCAAAAAA TTGATCTCCCAACATGGCGCACTGACGACTCTAGCATTTTGGTTCCCACATTTGCAAGAG TACGGTGGCCAAAAACCAGAATTGAGCAAGCCACATTTTGCATTAGAGGGTTCCGTCGCT GTGGCTGGTGCTGTGGTCCAATGGCTACGTGATAATTTACGATTGATCGATAAATCAGAG GATGTCGGACCGATTGCATCTACGGTTCCTGATTCTGGTGGCGTAGTTTTCGTCCCCGCA TTTAGTGGCCTATTCGCTCCCTATTGGGACCCAGATGCCAGAGCCACCATAATGGGGATG TCTCAATTCACTACTGCCTCCCACATCGCCAGAGCTGCCGTGGAAGGTGTTTGCTTTCAA GCCAGGGCTATCTTGAAGGCAATGAGTTCTGACGCGTTTGGTGAAGGTTCCAAAGACAGG GACTTTTTAGAGGAAATTTCCGACGTCACATATGAAAAGTCGCCCCTGTCGGTTCTGGCA GTGGATGGCGGGATGTCGAGGTCTAATGAAGTCATGCAAATTCAAGCCGATATCTTAGGT CCCTGTGTCAAAGTCAGAAGGTCTCCGACAGCGGAATGTACCGCATTGGGGGCAGCCATT GCAGCCAATATGGCTTTCAAGGATGTGAACGAGCGCCCATTATGGAAGGACCTACACGAT GTTAAGAAATGGGTCTTTTACAATGGAATGGAGAAAAACGAACAAATATCACCAGAGGCT CATCCAAACCTTAAGATATTCAGAAGTGAATCCGACGATGCTGAAAGGAGAAAGCATTGG AAGTATTGGGAAGTTGCCGTGGAAAGATCCAAAGGTTGGCTGAAGGACATAGAAGGTGAA CACGAACAGGTTCTAGAAAACTTCCAATAA
Protein Properties
Pfam Domain Function
Protein Residues709
Protein Molecular Weight79823.60156
Protein Theoretical pI8.15
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Glycerol kinase MFPSLFRLVVFSKRYIFRSSQRLYTSLKQEQSRMSKIMEDLRSDYVPLIASIDVGTTSSR CILFNRWGQDVSKHQIEYSTSASKGKIGVSGLRRPSTAPARETPNAGDIKTSGKPIFSAE GYAIQETKFLKIEELDLDFHNEPTLKFPKPGWVECHPQKLLVNVVQCLASSLLSLQTINS ERVANGLPPYKVICMGIANMRETTILWSRRTGKPIVNYGIVWNDTRTIKIVRDKWQNTSV DRQLQLRQKTGLPLLSTYFSCSKLRWFLDNEPLCTKAYEENDLMFGTVDTWLIYQLTKQK AFVSDVTNASRTGFMNLSTLKYDNELLEFWGIDKNLIHMPEIVSSSQYYGDFGIPDWIME KLHDSPKTVLRDLVKRNLPIQGCLGDQSASMVGQLAYKPGAAKCTYGTGCFLLYNTGTKK LISQHGALTTLAFWFPHLQEYGGQKPELSKPHFALEGSVAVAGAVVQWLRDNLRLIDKSE DVGPIASTVPDSGGVVFVPAFSGLFAPYWDPDARATIMGMSQFTTASHIARAAVEGVCFQ ARAILKAMSSDAFGEGSKDRDFLEEISDVTYEKSPLSVLAVDGGMSRSNEVMQIQADILG PCVKVRRSPTAECTALGAAIAANMAFKDVNERPLWKDLHDVKKWVFYNGMEKNEQISPEA HPNLKIFRSESDDAERRKHWKYWEVAVERSKGWLKDIEGEHEQVLENFQ
References
External Links
ResourceLink
Saccharomyces Genome Database GUT1
Uniprot IDP32190
Uniprot NameGLPK_YEAST
GenBank Gene IDU11583
Genebank Protein ID2289861
General Reference
  • Pavlik, P., Simon, M., Schuster, T., Ruis, H. (1993). "The glycerol kinase (GUT1) gene of Saccharomyces cerevisiae: cloning and characterization." Curr Genet 24:21-25.8358828
  • Johnston, M., Andrews, S., Brinkman, R., Cooper, J., Ding, H., Dover, J., Du, Z., Favello, A., Fulton, L., Gattung, S., et, a. l. .. (1994). "Complete nucleotide sequence of Saccharomyces cerevisiae chromosome VIII." Science 265:2077-2082.8091229
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356