You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
Name3'(2'),5'-bisphosphate nucleotidase
Synonyms
  • 3'(2'),5-bisphosphonucleoside 3'(2')-phosphohydrolase
  • DPNPase
  • Halotolerance protein HAL2
Gene NameHAL2
Enzyme Class
Biological Properties
General FunctionInvolved in 3'(2'),5'-bisphosphate nucleotidase activity
Specific FunctionConverts adenosine 3'-phosphate 5'-phosphosulfate (PAPS) to adenosine 5'-phosphosulfate (APS) and 3'(2')-phosphoadenosine 5'- phosphate (PAP) to AMP. Regulates the flux of sulfur in the sulfur-activation pathway by converting PAPS to APS. Involved in salt tolerance. Confers resistance to lithium
Cellular LocationCytoplasmic
SMPDB Pathways
Sulfur metabolismPW002483 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Sulfur metabolismec00920 Map00920
SMPDB ReactionsNot Available
KEGG Reactions
Adenosine 3',5'-diphosphate + waterAdenosine monophosphate + phosphate
Metabolites
YMDB IDNameView
YMDB00097Adenosine monophosphateShow
YMDB00349Adenosine 3',5'-diphosphateShow
YMDB00890waterShow
YMDB00907phosphateShow
GO Classification
Component
Not Available
Function
hydrolase activity
hydrolase activity, acting on ester bonds
phosphoric ester hydrolase activity
phosphatase activity
inositol or phosphatidylinositol phosphatase activity
nucleotidase activity
3'(2'),5'-bisphosphate nucleotidase activity
catalytic activity
Process
sulfur metabolic process
metabolic process
cellular metabolic process
Gene Properties
Chromosome LocationNot Available
LocusYOL064C
Gene Sequence>1074 bp ATGGCATTGGAAAGAGAATTATTGGTTGCAACTCAAGCTGTACGAAAGGCGTCTTTATTG ACTAAGAGAATTCAATCTGAAGTGATTTCTCACAAGGACTCCACTACTATTACCAAGAGT GATAATTCTCCAGTAACCACAGGTGATTATGCTGCACAAACGATCATCATAAATGCTATC ATGAGCAGTTTCCCTGATGATAAGGTGGTTGGTGAAGAATCCTCATCAGGATTGAGCGAC GCATTCGTCTCAGGAATTTTAAACGAAATAAAAGCCAATGACGAAGTTTATAACAAGAAT TATAAAAAGGATGATTTTCTGTTTACAAACGATCAGTTTCCGCTAAAATCTTTGGAGGAC GTCAGGCAAATCATCGATTTCGGCAATTACGAAGGTGGTAGAAAAGGAAGATTTTGGTGT TTGGATCCTATTGACGGAACCAAGGGGTTTTTAAGAGGCGAACAGTTTGCAGTATGTCTG GCCTTAATTGTGGACGGTGTTGTTCAGCTTGGTTGTATTGGATGCCCCAACTTAGTTTTA AGTTCTTATGGGGCCCAAGATTTGAAAGGCCATGAGTCATTTGGTTATATCTTTCGTGCT GTTAGAGGTTTAGGTGCCTTCTATTCTCCATCTTCAGATGCAGAGTCATGGACCAAAATC CACGTTAGACACTTAAAAGACACTAAAGACATGATTACTTTAGAGGGAGTTGAAAAGGGA CACTCCTCTCATGATGAACAAACTGCTATCAAAAACAAACTAAATATATCCAAATCTTTG CACTTGGATTCTCAAGCCAAGTACTGTTTGTTAGCATTGGGCTTAGCAGACGTATATTTA CGTCTGCCTATCAAACTTTCTTACCAAGAAAAGATCTGGGACCATGCTGCAGGCAACGTT ATTGTCCACGAAGCTGGTGGTGTCCATACAGATGCCATGGAAGATGTTCCTCTAGACTTC GGTAACGGTAGAACGCTAGCTACGAAGGGAGTTATAGCGTCAAGTGGCCCTCGCGAGTTA CATGACTTGGTGGTGTCTACATCATGCGATGTCATTCAGTCAAGGAACGCCTAA
Protein Properties
Pfam Domain Function
Protein Residues357
Protein Molecular Weight39148.89844
Protein Theoretical pI6.13
PDB Fileshow
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>3'(2'),5'-bisphosphate nucleotidase MALERELLVATQAVRKASLLTKRIQSEVISHKDSTTITKNDNSPVTTGDYAAQTIIINAI KSNFPDDKVVGEESSSGLSDAFVSGILNEIKANDEVYNKNYKKDDFLFTNDQFPLKSLED VRQIIDFGNYEGGRKGRFWCLDPIDGTKGFLRGEQFAVCLALIVDGVVQLGCIGCPNLVL SSYGAQDLKGHESFGYIFRAVRGLGAFYSPSSDAESWTKIHVRHLKDTKDMITLEGVEKG HSSHDEQTAIKNKLNISKSLHLDSQAKYCLLALGLADVYLRLPIKLSYQEKIWDHAAGNV IVHEAGGIHTDAMEDVPLDFGNGRTLATKGVIASSGPRELHDLVVSTSCDVIQSRNA
References
External Links
ResourceLink
Saccharomyces Genome Database HAL2
Uniprot IDP32179
Uniprot NameHAL2_YEAST
GenBank Gene IDAY500154
Genebank Protein ID40786813
PDB ID
1KA1
General Reference
  • Glaser, H. U., Thomas, D., Gaxiola, R., Montrichard, F., Surdin-Kerjan, Y., Serrano, R. (1993). "Salt tolerance and methionine biosynthesis in Saccharomyces cerevisiae involve a putative phosphatase gene." EMBO J 12:3105-3110.8393782
  • Tzermia, M., Katsoulou, C., Alexandraki, D. (1997). "Sequence analysis of a 33.2 kb segment from the left arm of yeast chromosome XV reveals eight known genes and ten new open reading frames including homologues of ABC transporters, inositol phosphatases and human expressed sequence tags." Yeast 13:583-589.9178509
  • Dujon, B., Albermann, K., Aldea, M., Alexandraki, D., Ansorge, W., Arino, J., Benes, V., Bohn, C., Bolotin-Fukuhara, M., Bordonne, R., Boyer, J., Camasses, A., Casamayor, A., Casas, C., Cheret, G., Cziepluch, C., Daignan-Fornier, B., Dang, D. V., de Haan, M., Delius, H., Durand, P., Fairhead, C., Feldmann, H., Gaillon, L., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XV." Nature 387:98-102.9169874
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Albert, A., Yenush, L., Gil-Mascarell, M. R., Rodriguez, P. L., Patel, S., Martinez-Ripoll, M., Blundell, T. L., Serrano, R. (2000). "X-ray structure of yeast Hal2p, a major target of lithium and sodium toxicity, and identification of framework interactions determining cation sensitivity." J Mol Biol 295:927-938.10656801