You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameTrehalose-phosphatase
Synonyms
  • Trehalose synthase complex catalytic subunit TPS2
  • Trehalose-6-phosphate phosphatase
  • TPP
Gene NameTPS2
Enzyme Class
Biological Properties
General FunctionInvolved in catalytic activity
Specific FunctionPhosphatase catalytic subunit of the trehalose synthase complex that catalyzes the production of trehalose from glucose-6- phosphate and UDP-glucose in a two step process
Cellular LocationCytoplasm
SMPDB Pathways
Starch and sucrose metabolismPW002481 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Starch and sucrose metabolismec00500 Map00500
SMPDB Reactions
Uridine diphosphate glucose + alpha-D-glucose 6 phosphateUridine 5'-diphosphate + Trehalose 6-phosphate
Trehalose 6-phosphate + waterTrehalose + phosphate
KEGG Reactions
water + Trehalose 6-phosphatephosphate + Trehalose
Metabolites
YMDB IDNameView
YMDB00008TrehaloseShow
YMDB00137Trehalose 6-phosphateShow
YMDB00212Uridine diphosphate glucoseShow
YMDB00307Uridine 5'-diphosphateShow
YMDB00890waterShow
YMDB00907phosphateShow
YMDB16263alpha-D-glucose 6 phosphateShow
GO Classification
Component
Not Available
Function
catalytic activity
Process
trehalose metabolic process
trehalose biosynthetic process
metabolic process
primary metabolic process
carbohydrate metabolic process
oligosaccharide metabolic process
disaccharide metabolic process
Gene Properties
Chromosome Locationchromosome 4
LocusYDR074W
Gene Sequence>2691 bp ATGACCACCACTGCCCAAGACAATTCTCCAAAGAAGAGACAGCGTATCATCAATTGTGTC ACGCAGCTGCCCTACAAAATCCAATTGGGAGAAAGCAACGATGACTGGAAAATATCTGCT ACTACAGGTAACAGCGCATTATATTCCTCTCTAGAATACCTTCAATTTGATTCTACCGAG TACGAGCAACACGTTGTTGGTTGGACCGGCGAAATAACAAGAACCGAACGCAACCTGTTT ACTAGAGAAGCGAAAGAGAAACCACAGGATCTGGACGATGACCCACTATATTTAACAAAA GAGCAGATCAATGGGTTGACTACTACTCTACAAGATCATATGAAATCTGATAAAGAGGCA AAGACCGATACTACTCAAACAGCTCCCGTTACCAATAACGTTCATCCCGTTTGGCTACTT AGAAAAAACCAGAGTAGATGGAGAAATTACGCGGAAAAAGTAATTTGGCCAACCTTCCAC TACATCTTGAATCCTTCAAATGAAGGTGAGCAAGAAAAAAACTGGTGGTACGACTACGTC AAGTTTAACGAAGCTTATGCACAAAAAATCGGGGAAGTTTACAGGAAGGGTGACATCATC TGGATCCATGACTACTACCTACTGCTATTGCCTCAACTACTGAGAATGAAATTTAACGAC GAATCTATCATTATTGGTTATTTCCATCATGCCCCATGGCCTAGTAATGAATATTTTCGC TGTTTGCCACGTAGAAAACAAATCTTAGATGGTCTTGTTGGGGCCAATAGAATTTGTTTC CAAAATGAATCTTTCTCCCGTCATTTTGTATCGAGTTGTAAAAGATTACTCGACGCAACC GCCAAGAAATCTAAAAACTCTTCCGATAGTGATCAATATCAAGTGTCTGTGTACGGTGGT GACGTACTCGTAGATTCTTTGCCTATAGGTGTTAACACAACTCAAATACTGAAAGATGCT TTCACGAAGGATATAGATTCCAAGGTTCTTTCCATCAAGCAAGCTTATCAAAACAAAAAA ATTATTATTGGTAGAGATCGTCTGGATTCCGTCAGAGGCGTCGTTCAAAAATTAAGAGCT TTTGAAACTTTCTTGGCCATGTATCCAGAATGGCGAGATCAAGTGGTATTGATCCAGGTC AGCAGTCCTACTGCTAACAGAAATTCCCCCCAAACTATCAGATTGGAACAACAAGTCAAC GAGTTGGTTAATTCCATAAATTCTGAATATGGTAATTTGAATTTTTCTCCCGTCCAGCAT TATTATATGAGAATCCCTAAAGATGTATACTTGTCCTTACTAAGAGTTGCAGACTTATGT TTAATCACAAGTGTTAGAGACGGTATGAATACCACTGCTTTGGAATACGTCACTGTGAAA TCTCACATGTCGAACTTTTTATGCTACGGAAATCCATTGATTTTAAGTGAGTTTTCTGGC TCTAGTAACGTATTGAAAGATGCCATTGTCGTTAACCCATGGGATTCGGTGGCCGTGGCT AAATCTATTAACATGGCTTTGAAATTGGACAAGGAAGAAAAGTCCAATTTAGAATCAAAA TTATGGAAAGAAGTTCCTACAATTCAAGATTGGACTAATAAGTTTTTGAGTTCATTAAAG GAAAAGGCGTCATCTGATGATGATGTGGAAAGGAAAATGACTCCAGCACTTAATAGACCT GTTCTTTTAGAAAACTACAAGCAGGCTAAGCGTAGATTATTCCTTTTTGATTACGATGGT ACTTTGACCCCAATTGTCAAAGACCCAGCTGCAGCTATTCCATCGGCAAGACTTTATACA ATTCTACAAAAATTATGTGCCGATCCTCATAATCAAATCTGGATTATTTCTGGTCGTGAC CAGAAGTTTTTGAACAAGTGGTTAGGCGGTAAACTTCCTCAACTGGGTCTAAGTGCGGAG CATGGATGTTTCATGAAAGATGTTTCTTGCCAAGATTGGGTCAATTTGACCGAAAAAGTT GATATGTCTTGGCAAGTACGCGTCAATGAAGTGATGGAAGAATTTACCACAAGGACCCCA GGTTCATTCATCGAAAGAAAGAAAGTCGCTCTAACTTGGCATTATAGACGTACCGTTCCA GAATTGGGTGAATTCCACGCCAAAGAACTGAAAGAAAAATTGTTATCATTTACTGATGAC TTCGATTTAGAGGTCATGGATGGTAAAGCAAACATTGAAGTTCGTCCAAGATTCGTCAAC AAAGGTGAAATAGTCAAGAGACTAGTCTGGCATCAACATGGCAAACCACAGGACATGTTG AAGGGAATCAGTGAAAAACTACCTAAGGATGAAATGCCTGATTTTGTATTATGTCTGGGT GATGACTTCACTGACGAAGACATGTTTAGACAGTTGAATACCATTGAAACTTGTTGGAAA GAAAAATATCCTGACCAAAAAAATCAATGGGGCAACTACGGATTCTATCCTGTCACTGTG GGATCTGCATCCAAGAAAACTGTCGCAAAGGCTCATTTAACCGATCCTCAGCAAGTCCTG GAGACTTTAGGTTTACTTGTTGGTGATGTCTCTCTCTTCCAAAGTGCTGGTACGGTCGAC CTGGATTCCAGAGGTCATGTCAAGAATAGTGAGAGCAGTTTGAAATCAAAGCTAGCATCT AAAGCTTATGTTATGAAAAGATCGGCTTCTTACACCGGCGCAAAGGTTTGA
Protein Properties
Pfam Domain Function
Protein Residues896
Protein Molecular Weight102976.0
Protein Theoretical pI8.29
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Trehalose-phosphatase MTTTAQDNSPKKRQRIINCVTQLPYKIQLGESNDDWKISATTGNSALFSSLEYLQFDSTE YEQHVVGWTGEITRTERNLFTREAKEKPQDLDDDPLYLTKEQINGLTTTLQDHMKSDKEA KTDTTQTAPVTNNVHPVWLLRKNQSRWRNYAEKVIWPTFHYILNPSNEGEQEKNWWYDYV KFNEAYAQKIGEVYRKGDIIWIHDYYLLLLPQLLRMKFNDESIIIGYFHHAPWPSNEYFR CLPRRKQILDGLVGANRICFQNESFSRHFVSSCKRLLDATAKKSKNSSNSDQYQVSVYGG DVLVDSLPIGVNTTQILKDAFTKDIDSKVLSIKQAYQNKKIIIGRDRLDSVRGVVQKLRA FETFLAMYPEWRDQVVLIQVSSPTANRNSPQTIRLEQQVNELVNSINSEYGNLNFSPVQH YYMRIPKDVYLSLLRVADLCLITSVRDGMNTTALEYVTVKSHMSNFLCYGNPLILSEFSG SSNVLKDAIVVNPWDSVAVAKSINMALKLDKEEKSNLESKLWKEVPTIQDWTNKFLSSLK EQASSNDDMERKMTPALNRPVLLENYKQAKRRLFLFDYDGTLTPIVKDPAAAIPSARLYT ILQKLCADPHNQIWIISGRDQKFLNKWLGGKLPQLGLSAEHGCFMKDVSCQDWVNLTEKV DMSWQVRVNEVMEEFTTRTPGSFIERKKVALTWHYRRTVPELGEFHAKELKEKLLSFTDD FDLEVMDGKANIEVRPRFVNKGEIVKRLVWHQHGKPQDMLKGISEKLPKDEMPDFVLCLG DDFTDEDMFRQLNTIETCWKEKYPDQKNQWGNYGFYPVTVGSASKKTVAKAHLTDPQQVL ETLGLLVGDVSLFQSAGTVDLDSRGHVKNSESSLKSKLASKAYVMKRSASYTGAKV
References
External Links
ResourceLink
Saccharomyces Genome Database TPS2
Uniprot IDP31688
Uniprot NameTPS2_YEAST
GenBank Gene IDX70694
Genebank Protein ID406769
General Reference
  • De Virgilio, C., Burckert, N., Bell, W., Jeno, P., Boller, T., Wiemken, A. (1993). "Disruption of TPS2, the gene encoding the 100-kDa subunit of the trehalose-6-phosphate synthase/phosphatase complex in Saccharomyces cerevisiae, causes accumulation of trehalose-6-phosphate and loss of trehalose-6-phosphate phosphatase activity." Eur J Biochem 212:315-323.8444170
  • Jacq, C., Alt-Morbe, J., Andre, B., Arnold, W., Bahr, A., Ballesta, J. P., Bargues, M., Baron, L., Becker, A., Biteau, N., Blocker, H., Blugeon, C., Boskovic, J., Brandt, P., Bruckner, M., Buitrago, M. J., Coster, F., Delaveau, T., del Rey, F., Dujon, B., Eide, L. G., Garcia-Cantalejo, J. M., Goffeau, A., Gomez-Peris, A., Zaccaria, P., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV." Nature 387:75-78.9169867
  • Ronne, H., Carlberg, M., Hu, G. Z., Nehlin, J. O. (1991). "Protein phosphatase 2A in Saccharomyces cerevisiae: effects on cell growth and bud morphogenesis." Mol Cell Biol 11:4876-4884.1656215
  • Vandercammen, A., Francois, J., Hers, H. G. (1989). "Characterization of trehalose-6-phosphate synthase and trehalose-6-phosphate phosphatase of Saccharomyces cerevisiae." Eur J Biochem 182:613-620.2546763
  • Reinders, A., Burckert, N., Hohmann, S., Thevelein, J. M., Boller, T., Wiemken, A., De Virgilio, C. (1997). "Structural analysis of the subunits of the trehalose-6-phosphate synthase/phosphatase complex in Saccharomyces cerevisiae and their function during heat shock." Mol Microbiol 24:687-695.9194697
  • Bell, W., Sun, W., Hohmann, S., Wera, S., Reinders, A., De Virgilio, C., Wiemken, A., Thevelein, J. M. (1998). "Composition and functional analysis of the Saccharomyces cerevisiae trehalose synthase complex." J Biol Chem 273:33311-33319.9837904
  • Ficarro, S. B., McCleland, M. L., Stukenberg, P. T., Burke, D. J., Ross, M. M., Shabanowitz, J., Hunt, D. F., White, F. M. (2002). "Phosphoproteome analysis by mass spectrometry and its application to Saccharomyces cerevisiae." Nat Biotechnol 20:301-305.11875433
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Gruhler, A., Olsen, J. V., Mohammed, S., Mortensen, P., Faergeman, N. J., Mann, M., Jensen, O. N. (2005). "Quantitative phosphoproteomics applied to the yeast pheromone signaling pathway." Mol Cell Proteomics 4:310-327.15665377
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956