You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameNucleoside transporter FUN26
SynonymsNot Available
Gene NameFUN26
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in nucleoside transmembrane transporter activity
Specific FunctionHas broad nucleoside selectivity (uridine, ademosine and cytidine) and most likely functions to transport nucleosides across intracellular membranes
Cellular LocationMembrane; Multi-pass membrane protein (Potential)
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00051CytidineShow
YMDB00058AdenosineShow
YMDB00862hydronShow
GO Classification
Component
cell part
membrane
Function
transmembrane transporter activity
substrate-specific transmembrane transporter activity
nucleobase, nucleoside, nucleotide and nucleic acid transmembrane transporter activity
nucleoside transmembrane transporter activity
transporter activity
Process
establishment of localization
transport
Gene Properties
Chromosome Locationchromosome 1
LocusYAL022C
Gene Sequence>1554 bp ATGAGTACTAGTGCGGACACTGATACCATCAAGAAGCCAATCCTTGCGGTGCCAGAGCCT GCACTGGCCGATACGCATTCAGAGGAGATATCACGCTCTGGAGAAGAACATGAATCAGAG AACAACGAGCACTCAGATGAAGAAGGCGATAATTATTCTGAAAGAGAGCAATCTGTGTCA ACCGAACCACTGGATACATTGCCGTTAAGAAAAAAGTTGAAAAATCTTTCATATATTACA TTTTTCGCCATAGGAATAGGTCTTTTATGGCCGTGGAACTGTATCCTCAGTGCCTCGCAA TATTTTAAGCACGATATTTTCAAAGACACCTCCATTTGGGCAAAGATCTTCACAAGCTCT ATGATGTCCTTTTCTACCATATCGTCAATGCTGTTCAACATCTACTTGGCCAAAAGACAG TACAAATACTCGAGAAGGGTCATAAACGGGCTTGTGTGGGAGATTATTGTCTTTACTGTC ATGTGCTTCTTTACAATTTTGCATTTCCTTTTACCTAAATGGTTCAATTTCATGTTTATA ATGATGCTTGTAGTGATCAGTTCCATGGGGACAGCCATGACACAGAATGGTATCATGGCC ATAGCCAACGTCTTCGGTTCCGAGTACAGTCAAGGTGTCATGGTGGGGCAAGCCGTTGCT GGTGTCCTGCCCTCCCTAGTGCTTTTTGCCCTAGCTTTCATCGAGAACTCTTCTGTGTCT ACTACGGGCGGGATTCTTCTATACTTTTTTACCACAACACTCGTGGTCACCATTTGTGTG GTCATGTTCAGCGTGAGCAAAATCAGTCGGAAAGTGAACGAGAATTGGAATGTGGAAGAC GGACATATCACTGATGTGTTGTTAGGGTCTCTGCGCTCCAATGAGGAGGAAATCCGTATT GTTGGCCGCATTGACCAAATGGAGGATGAAGACCACCGCCGCACCAACGGCACTCGCGAC GACAACGACGAAGGTGAGGAACTCCAACTAAAAGTGCCTTTCGAGGTCTTATTTGCCAAA CTAAAGTACCTGGTTCTTTCCATATTCACCACGTTTGTCGTAACTCTTGTTTTTCCTGTA TTTGCGTCTGCCACCTACGTGACAGGGCTTCCTTTAAGCAACGCACAGTACATACCTCTC ATATTCACGCTGTGGAACCTAGGCGACCTTTACGGAAGAGTCATTGCCGACTGGCCCATG TTCCGTGACCAGAAATTTACGCCACGCAAAACCTTCATCTACTCATTGTTGCGGGTGGCC GCAATACCACTGTTCTTGATGTTCACAGCCATCACCTCCTCTTCAAGCGGCGATGAAGAG CACAATGGCTCCGTAATCGTTGACTTGTGTTACATGCTACTGCAGTTCCTTTTCGGCGTA ACCAACGGGCACGTCATCTCTATGAGTTTCATGAAGGTGCCAGAGCAACTGGACAACGAC GACGAGAAGGAAGCGGCCGGTGGATTCACTAATATTTTCGTTTCTACAGGACTAGCTCTG GGCAGCATCATAAGCTACGTATTCGTCTTCATAATTGACTTTATTATCAGGTAG
Protein Properties
Pfam Domain Function
Protein Residues517
Protein Molecular Weight58316.69922
Protein Theoretical pI4.69
Signalling Regions
  • None
Transmembrane Regions
  • 76-96
  • 116-136
  • 151-171
  • 174-194
  • 214-234
  • 243-263
  • 344-364
  • 367-387
  • 411-431
  • 446-466
  • 492-512
Protein Sequence>Nucleoside transporter FUN26 MSTSADTDTIKKPILAVPEPALADTHSEEISRSGEEHESENNEHSDEEGDNYSEREQSVS TEPLDTLPLRKKLKNLSYITFFAIGIGLLWPWNCILSASQYFKHDIFKDTSIWAKIFTSS MMSFSTISSMLFNIYLAKRQYKYSRRVINGLVWEIIVFTVMCFFTILHFLLPKWFNFMFI MMLVVISSMGTAMTQNGIMAIANVFGSEYSQGVMVGQAVAGVLPSLVLFALAFIENSSVS TTGGILLYFFTTTLVVTICVVMFSVSKISRKVNENWNVEDGHITDVLLGSLRSNEEEIRI VGRIDQMEDEDHRRTNGTRDDNDEGEELQLKVPFEVLFAKLKYLVLSIFTTFVVTLVFPV FASATYVTGLPLSNAQYIPLIFTLWNLGDLYGRVIADWPMFRDQKFTPRKTFIYSLLRVA AIPLFLMFTAITSSSSGDEEHNGSVIVDLCYMLLQFLFGVTNGHVISMSFMKVPEQLDND DEKEAAGGFTNIFVSTGLALGSIISYVFVFIIDFIIR
References
External Links
ResourceLink
Saccharomyces Genome Database FUN26
Uniprot IDP31381
Uniprot NameFUN26_YEAST
GenBank Gene IDL05146
Genebank Protein ID171853
General Reference
  • Ouellette, B. F., Clark, M. W., Keng, T., Storms, R. K., Zhong, W., Zeng, B., Fortin, N., Delaney, S., Barton, A., Kaback, D. B., et, a. l. .. (1993). "Sequencing of chromosome I from Saccharomyces cerevisiae: analysis of a 32 kb region between the LTE1 and SPO7 genes." Genome 36:32-42.8458570
  • Bussey, H., Kaback, D. B., Zhong, W., Vo, D. T., Clark, M. W., Fortin, N., Hall, J., Ouellette, B. F., Keng, T., Barton, A. B., et, a. l. .. (1995). "The nucleotide sequence of chromosome I from Saccharomyces cerevisiae." Proc Natl Acad Sci U S A 92:3809-3813.7731988
  • Vickers, M. F., Yao, S. Y., Baldwin, S. A., Young, J. D., Cass, C. E. (2000). "Nucleoside transporter proteins of Saccharomyces cerevisiae. Demonstration of a transporter (FUI1) with high uridine selectivity in plasma membranes and a transporter (FUN26) with broad nucleoside selectivity in intracellular membranes." J Biol Chem 275:25931-25938.10827169
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956