You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameLong-chain-fatty-acid--CoA ligase 1
Synonyms
  • Fatty acid activator 1
  • Long-chain acyl-CoA synthetase 1
Gene NameFAA1
Enzyme Class
Biological Properties
General FunctionInvolved in catalytic activity
Specific FunctionEsterification, concomitant with transport, of exogenous long-chain fatty acids into metabolically active CoA thioesters for subsequent degradation or incorporation into phospholipids. It may supplement intracellular myristoyl-CoA pools from exogenous myristate. Preferentially acts on C12:0-C16:0 fatty acids with myristic and pentadecanic acid (C15:0) having the highest activities
Cellular LocationNot Available
SMPDB Pathways
Biosynthesis of unsaturated fatty acidsPW002403 ThumbThumb?image type=greyscaleThumb?image type=simple
Fatty acid metabolismPW002460 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Biosynthesis of unsaturated fatty acidsec01040 Map01040
Fatty acid metabolismec00071 Map00071
SMPDB Reactions
Palmitic acid + Adenosine triphosphate + Coenzyme AAdenosine monophosphate + Pyrophosphate + Palmityl-CoA
KEGG Reactions
Adenosine triphosphate + myristic acid + Coenzyme AAdenosine monophosphate + Pyrophosphate + Tetradecanoyl-CoA
Adenosine triphosphate + Myristoleic acid + Coenzyme AAdenosine monophosphate + Pyrophosphate
Metabolites
YMDB IDNameView
YMDB00045Coenzyme AShow
YMDB00069Palmitic acidShow
YMDB00097Adenosine monophosphateShow
YMDB00109Adenosine triphosphateShow
YMDB001134-Phospho-L-aspartic acidShow
YMDB00219PyrophosphateShow
YMDB00301Palmityl-CoAShow
YMDB00469hexadec-2-enoyl-CoAShow
YMDB00527palmitoyl-CoAShow
YMDB00528myristoyl-CoAShow
YMDB00538stearoyl-CoAShow
YMDB00539oleoyl-CoAShow
YMDB00679myristic acidShow
YMDB00680Myristoleic acidShow
YMDB00681palmitoleic acidShow
YMDB00682stearic acidShow
YMDB00884Linoleic acidShow
GO Classification
Component
Not Available
Function
catalytic activity
Process
metabolic process
Gene Properties
Chromosome Locationchromosome 15
LocusYOR317W
Gene Sequence>2103 bp ATGGTTGCTCAATATACCGTTCCAGTTGGGAAAGCCGCCAATGAGCATGAAACTGCTCCA AGAAGAAATTATCAATGCCGCGAGAAGCCGCTCGTCAGACCGCCTAACACAAAGTGTTCC ACTGTTTATGAGTTTGTTCTAGAGTGCTTTCAGAAGAACAAAAATTCAAATGCTATGGGT TGGAGGGATGTTAAGGAAATTCATGAAGAATCCAAATCGGTTATGAAAAAAGTTGATGGC AAGGAGACTTCAGTGGAAAAGAAATGGATGTATTATGAACTATCGCATTATCATTATAAT TCATTTGACCAATTGACCGATATCATGCATGAAATTGGTCGTGGGTTGGTGAAAATAGGA TTAAAGCCTAATGATGATGACAAATTACATCTTTACGCAGCCACTTCTCACAAGTGGATG AAGATGTTCTTAGGAGCGCAGTCTCAAGGTATTCCTGTCGTCACTGCCTACGATACTTTG GGAGAGAAAGGGCTAATTCATTCTTTGGTGCAAACGGGGTCTAAGGCCATTTTTACCGAT AACTCTTTATTACCATCCTTGATCAAACCAGTGCAAGCCGCTCAAGACGTAAAATACATA ATTCATTTCGATTCCATCAGTTCTGAGGACAGGAGGCAAAGTGGTAAGATCTATCAATCT GCTCATGATGCCATCAACAGAATTAAAGAAGTTAGACCTGATATCAAGACCTTTAGCTTT GACGACATCTTGAAGCTAGGTAAAGAATCCTGTAACGAAATCGATGTTCATCCACCTGGC AAGGATGATCTTTGTTGCATCATGTATACGTCTGGTTCTACAGGTGAGCCAAAGGGTGTT GTCTTGAAACATTCAAATGTTGTCGCAGGTGTTGGTGGTGCAAGTTTGAATGTTTTGAAG TTTGTGGGCAATACCGACCGTGTTATCTGTTTTTTGCCACTAGCTCATATTTTTGAATTG GTTTTCGAACTATTGTCCTTTTATTGGGGGGCCTGCATTGGTTATGCCACCGTAAAAACT TTAACTAGCAGCTCTGTGAGAAATTGTCAAGGTGATTTGCAAGAATTCAAGCCCACAATC ATGGTTGGTGTCGCCGCTGTTTGGGAAACAGTGAGAAAAGGGATCTTAAACCAAATTGAT AATTTGCCCTTCCTCACCAAGAAAATCTTCTGGACCGCGTATAATACCAAGTTGAACATG CAACGTCTCCACATCCCTGGTGGCGGCGCCTTAGGAAACTTGGTTTTCAAAAAAATCAGA ACTGCCACAGGTGGCCAATTAAGATATTTGTTAAACGGTGGTTCTCCAATCAGTCGGGAT GCTCAGGAATTCATCACAAATTTAATCTGCCCTATGCTTATTGGTTACGGTTTAACCGAG ACATGCGCTAGTACCACCATCTTGGATCCTGCTAATTTTGAACTCGGCGTCGCTGGTGAC CTAACAGGTTGTGTTACCGTCAAACTAGTTGATGTTGAAGAATTAGGTTATTTTGCTAAA AACAACCAAGGTGAAGTTTGGATCACAGGTGCCAATGTCACGCCTGAATATTATAAGAAT GAGGAAGAAACTTCTCAAGCTTTAACAAGCGATGGTTGGTTCAAGACCGGTGACATCGGT GAATGGGAAGCAAATGGCCATTTGAAAATAATTGACAGGAAGAAAAACTTGGTCAAAACA ATGAACGGTGAATATATCGCACTCGAGAAATTAGAGTCCGTTTACAGATCTAACGAATAT GTTGCTAACATTTGTGTTTATGCCGACCAATCTAAGACTAAGCCAGTTGGTATTATTGTA CCAAATCATGCTCCATTAACGAAGCTTGCTAAAAAGTTGGGAATTATGGAACAAAAAGAC AGTTCAATTAATATCGAAAATTATTTGGAGGATGCAAAATTGATTAAAGCTGTTTATTCT GATCTTTTGAAGACAGGTAAAGACCAAGGTTTGGTTGGCATTGAATTACTAGCAGGCATA GTGTTCTTTGACGGCGAATGGACTCCACAAAACGGTTTTGTTACGTCCGCTCAGAAATTG AAAAGAAAAGACATTTTGAATGCTGTCAAAGATAAAGTTGACGCCGTTTATAGTTCGTCT TAA
Protein Properties
Pfam Domain Function
Protein Residues700
Protein Molecular Weight77865.79688
Protein Theoretical pI7.69
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Long-chain-fatty-acid--CoA ligase 1 MVAQYTVPVGKAANEHETAPRRNYQCREKPLVRPPNTKCSTVYEFVLECFQKNKNSNAMG WRDVKEIHEESKSVMKKVDGKETSVEKKWMYYELSHYHYNSFDQLTDIMHEIGRGLVKIG LKPNDDDKLHLYAATSHKWMKMFLGAQSQGIPVVTAYDTLGEKGLIHSLVQTGSKAIFTD NSLLPSLIKPVQAAQDVKYIIHFDSISSEDRRQSGKIYQSAHDAINRIKEVRPDIKTFSF DDILKLGKESCNEIDVHPPGKDDLCCIMYTSGSTGEPKGVVLKHSNVVAGVGGASLNVLK FVGNTDRVICFLPLAHIFELVFELLSFYWGACIGYATVKTLTSSSVRNCQGDLQEFKPTI MVGVAAVWETVRKGILNQIDNLPFLTKKIFWTAYNTKLNMQRLHIPGGGALGNLVFKKIR TATGGQLRYLLNGGSPISRDAQEFITNLICPMLIGYGLTETCASTTILDPANFELGVAGD LTGCVTVKLVDVEELGYFAKNNQGEVWITGANVTPEYYKNEEETSQALTSDGWFKTGDIG EWEANGHLKIIDRKKNLVKTMNGEYIALEKLESVYRSNEYVANICVYADQSKTKPVGIIV PNHAPLTKLAKKLGIMEQKDSSINIENYLEDAKLIKAVYSDLLKTGKDQGLVGIELLAGI VFFDGEWTPQNGFVTSAQKLKRKDILNAVKDKVDAVYSSS
References
External Links
ResourceLink
Saccharomyces Genome Database FAA1
Uniprot IDP30624
Uniprot NameLCF1_YEAST
GenBank Gene IDX66194
Genebank Protein ID3692
General Reference
  • Duronio, R. J., Knoll, L. J., Gordon, J. I. (1992). "Isolation of a Saccharomyces cerevisiae long chain fatty acyl:CoA synthetase gene (FAA1) and assessment of its role in protein N-myristoylation." J Cell Biol 117:515-529.1572893
  • Pearson, B. M., Hernando, Y., Payne, J., Wolf, S. S., Kalogeropoulos, A., Schweizer, M. (1996). "Sequencing of a 35.71 kb DNA segment on the right arm of yeast chromosome XV reveals regions of similarity to chromosomes I and XIII." Yeast 12:1021-1031.8896266
  • Dujon, B., Albermann, K., Aldea, M., Alexandraki, D., Ansorge, W., Arino, J., Benes, V., Bohn, C., Bolotin-Fukuhara, M., Bordonne, R., Boyer, J., Camasses, A., Casamayor, A., Casas, C., Cheret, G., Cziepluch, C., Daignan-Fornier, B., Dang, D. V., de Haan, M., Delius, H., Durand, P., Fairhead, C., Feldmann, H., Gaillon, L., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XV." Nature 387:98-102.9169874
  • Knoll, L. J., Johnson, D. R., Gordon, J. I. (1994). "Biochemical studies of three Saccharomyces cerevisiae acyl-CoA synthetases, Faa1p, Faa2p, and Faa3p." J Biol Chem 269:16348-16356.8206942
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956