You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameOrotate phosphoribosyltransferase 2
Synonyms
  • OPRT 2
  • OPRTase 2
Gene NameURA10
Enzyme Class
Biological Properties
General FunctionInvolved in orotate phosphoribosyltransferase activity
Specific FunctionCatalyzes the transfer of a ribosyl phosphate group from 5-phosphoribose 1-diphosphate to orotate, leading to the formation of orotidine monophosphate (OMP)
Cellular LocationNot Available
SMPDB Pathways
Pyrimidine metabolismPW002469 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Pyrimidine metabolismec00240 Map00240
SMPDB Reactions
Orotic acid + Phosphoribosyl pyrophosphatePyrophosphate + Orotidylic acid
KEGG Reactions
Pyrophosphate + Orotidylic acidOrotic acid + Phosphoribosyl pyrophosphate
Metabolites
YMDB IDNameView
YMDB00025Orotidylic acidShow
YMDB00219PyrophosphateShow
YMDB00402Phosphoribosyl pyrophosphateShow
YMDB00405Orotic acidShow
GO Classification
Component
Not Available
Function
transferase activity, transferring pentosyl groups
orotate phosphoribosyltransferase activity
catalytic activity
transferase activity
transferase activity, transferring glycosyl groups
Process
cellular nitrogen compound metabolic process
nucleobase, nucleoside, nucleotide and nucleic acid metabolic process
nucleobase, nucleoside and nucleotide metabolic process
nucleoside phosphate metabolic process
nucleotide metabolic process
pyrimidine nucleotide metabolic process
pyrimidine nucleotide biosynthetic process
nucleoside metabolic process
metabolic process
nitrogen compound metabolic process
Gene Properties
Chromosome Locationchromosome 13
LocusYMR271C
Gene Sequence>684 bp ATGTCTGCATCTACTACAAGTTTAGAGGAATATCAAAAAACTTTCCTTGAACTGGGATTA GAATGCAAAGCACTAAGATTTGGGTCATTCAAGCTGAATTCAGGCAGGCAGTCGCCATAT TTTTTCAATCTTAGTTTGTTCAATTCTGGAAAGCTGTTGGCAAACCTTGCCACCGCGTAT GCAACTGCTATCATTCAATCGGAGCTTAAATTCGATGTTATTTTCGGACCTGCTTACAAA GGGATCCCTTTGGCTGCTATTGTATGCGTTAAACTAGCAGAAATCGGGGGCACTAAATTT CAAGGTATTCAATATGCTTTTAATAGAAAGAAAGTTAAAGACCACGGCGAAGGTGGTATT ATTGTTGGAGCATCGCTTGAAGACAAGAGGGTGTTGATTATCGACGATGTCATGACTGCA GGAACTGCAATCAATGAAGCATTTGAGATAATCAGTATTGCTCAAGGTAGGGTAGTGGGT TGTATTGTTGCTTTAGATAGGCAAGAAGTGATTCATGAATCTGATCCGGAAAGAACAAGT GCTACCCAATCTGTTTCAAAGAGATACAACGTTCCTGTGCTAAGTATTGTATCACTGACT CAAGTGGTACAATTTATGGGAAATAGACTATCACCAGAGCAAAAATCAGCGATTGAAAAC TACCGTAAGGCCTATGGTATATGA
Protein Properties
Pfam Domain Function
Protein Residues227
Protein Molecular Weight24810.30078
Protein Theoretical pI8.76
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Orotate phosphoribosyltransferase 2 MSASTTSLEEYQKTFLELGLECKALRFGSFKLNSGRQSPYFFNLSLFNSGKLLANLATAY ATAIIQSELKFDVIFGPAYKGIPLAAIVCVKLAEIGGTKFQGIQYAFNRKKVKDHGEGGI IVGASLEDKRVLIIDDVMTAGTAINEAFEIISIAQGRVVGCIVALDRQEVIHESDPERTS ATQSVSKRYNVPVLSIVSLTQVVQFMGNRLSPEQKSAIENYRKAYGI
References
External Links
ResourceLink
Saccharomyces Genome Database URA10
Uniprot IDP30402
Uniprot NamePYRX_YEAST
GenBank Gene IDAY557976
Genebank Protein ID45269844
General Reference
  • de Montigny, J., Kern, L., Hubert, J. C., Lacroute, F. (1990). "Cloning and sequencing of URA10, a second gene encoding orotate phosphoribosyl transferase in Saccharomyces cerevisiae." Curr Genet 17:105-111.2182197
  • Hohmann, S., Van Dijck, P., Luyten, K., Thevelein, J. M. (1994). "The byp1-3 allele of the Saccharomyces cerevisiae GGS1/TPS1 gene and its multi-copy suppressor tRNA(GLN) (CAG): Ggs1/Tps1 protein levels restraining growth on fermentable sugars and trehalose accumulation." Curr Genet 26:295-301.7882422
  • Bowman, S., Churcher, C., Badcock, K., Brown, D., Chillingworth, T., Connor, R., Dedman, K., Devlin, K., Gentles, S., Hamlin, N., Hunt, S., Jagels, K., Lye, G., Moule, S., Odell, C., Pearson, D., Rajandream, M., Rice, P., Skelton, J., Walsh, S., Whitehead, S., Barrell, B. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XIII." Nature 387:90-93.9169872
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106