You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameChitin synthase 3
Synonyms
  • Chitin-UDP acetyl-glucosaminyl transferase 3
  • Class-IV chitin synthase 3
Gene NameCHS3
Enzyme Class
Biological Properties
General FunctionInvolved in transferase activity, transferring hexosyl groups
Specific FunctionAppears to be responsible for the synthesis of the majority of the chitin found in the cell wall periphery. It is involved in the synthesis of the chitin ring that forms in the cell wall just before bud emergence. This ring remains at the base of the bud as the bud grows and ultimately forms part of the bud scar marking the division site on the mother cell
Cellular LocationMembrane; Multi-pass membrane protein
SMPDB Pathways
Amino sugar and nucleotide sugar metabolismPW002413 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Amino sugar and nucleotide sugar metabolismec00520 Map00520
SMPDB Reactions
Uridine diphosphate-N-acetylglucosamine + ChitinUridine 5'-diphosphate + Chitin
KEGG Reactions
Uridine diphosphate-N-acetylglucosamine → chitin + Uridine 5'-diphosphate + hydron
Metabolites
YMDB IDNameView
YMDB00277Uridine diphosphate-N-acetylglucosamineShow
YMDB00307Uridine 5'-diphosphateShow
YMDB00862hydronShow
YMDB16156ChitinShow
GO Classification
Component
Not Available
Function
transferase activity, transferring glycosyl groups
transferase activity, transferring hexosyl groups
catalytic activity
transferase activity
Process
Not Available
Gene Properties
Chromosome Locationchromosome 2
LocusYBR023C
Gene Sequence>3498 bp ATGACCGGCTTGAATGGAGATGATCCTGATGACTACTATCTGAACCTTAATCAAGATGAA GAGTCTCTACTTAGGTCAAGACACAGTGTCGGCTCAGGAGCACCTCATAGACAAGGCTCT TTAGTGCGGCCCGAAAGAAGCCGACTGAACAATCCTGATAATCCACATTTTTATTATGCG CAGAAAACGCAGGAGCAGATGAATCACCTGGATGTTTTACCATCAAGTACCGGTGTAAAC CCAAATGCAACTCGTCGGAGTGGCTCCCTGCGCTCCAAAGGCTCAGTGAGAAGCAAATTT AGTGGCCGCGAAACGGATAGCTATCTTTTACAAGATATGAATACTACTGACAAGAAGGCT TCCGTTAAAATAAGTGATGAAGGTGTTGCGGAAGACGAATTTGATAAAGATGGTGATGTG GACAATTTCGAAGAAAGCTCCACGCAGCCCATAAATAAGTCTATCAAACCATTAAGAAAG GAAACGAATGATACATTGTCATTTTGGCAGATGTACTGTTATTTCATTACGTTTTGGGCA CCTGCTCCAATTCTTGCTTTCTGCGGGATGCCAAAGAAGGAAAGACAAATGGCGTGGAGA GAAAAGGTTGCTTTAATTTCTGTCATCTTGTACATTGGTGCGATTGTGGCTTTCCTGACT TTTGGTTTCACTAAAACCGTTTGTAGTAGTTCGAAACTACGTTTGAAAAACAACGAAGTA TCAACAGAATTTGTCGTAATTAACGGTAAGGCTTATGAATTGGATACTTCCTCGCGTTCC GGTATACAAGACGTTGAAGTAGATTCAGACACCCTTTATGGGCCCTGGTCAGATGCTGGT AAAGATGCTTCGTTCTTGTTTCAAAATGTGAATGGTAACTGTCATAACCTTATAACTCCA AAGAGTAATTCTTCCATTCCCCATGACGATGATAATAATTTAGCATGGTATTTTCCTTGT AAGTTAAAGAATCAAGATGGCTCTTCGAAGCCAAACTTCACAGTTGAAAATTACGCAGGA TGGAACTGTCATACGTCTAAAGAAGATAGGGACGCATTTTACGGTTTAAAGTCGAAAGCT GATGTTTACTTCACTTGGGATGGTATAAAGAACTCTTCTAGAAACTTGATTGTTTATAAT GGCGACGTTTTGGATTTAGATCTTCTTGATTGGTTGGAAAAGGATGACGTTGACTATCCC GTTGTATTCGATGACTTGAAGACTTCAAATTTACAAGGTTATGATCTTTCGTTGGTTTTG TCAAATGGGCATGAAAGAAAAATTGCGAGATGTTTGAGCGAAATTATTAAAGTTGGTGAA GTAGACTCCAAAACCGTCGGTTGTATTGCCTCTGATGTCGTTTTGTATGTTTCTCTGGTA TTTATTCTTTCAGTGGTGATAATTAAATTCATAATTGCCTGCTACTTCCGTTGGACTGTA GCTAGGAAACAAGGTGCATATATCGTGGACAATAAAACAATGGATAAACACACAAACGAT ATCGAGGATTGGTCTAATAATATTCAAACAAAAGCTCCTCTAAAGGAAGTAGATCCTCAT TTGAGGCCAAAGAAATACTCAAAAAAGTCGTTGGGACACAAGCGTGCTTCAACCTTTGAC TTGCTGAAAAAACACAGCTCCAAAATGTTTCAATTTAACGAATCTGTGATAGATCTAGAC ACCTCCATGAGCAGTTCACTACAATCTTCTGGTTCATACAGAGGAATGACAACAATGACC ACTCAAAATGCTTGGAAACTCTCGAATGAAAACAAAGCTGTACATTCCCGTAATCCATCT ACTTTGTTGCCTACATCCTCGATGTTTTGGAATAAAGCGACTTCCTCTCCTGTACCAGGA TCATCGCTGATTCAGAGTCTTGATTCGACGATTATACATCCCGATATCGTTCAACAACCA CCACTGGATTTTATGCCATACGGGTTCCCATTGATTCATACTATCTGTTTTGTTACTTGT TATTCTGAGGATGAAGAGGGTTTAAGAACCACTTTAGACTCTCTTTCTACCACAGATTAT CCAAATTCCCATAAACTACTGATGGTTGTTTGTGATGGTTTAATTAAGGGCTCGGGCAAC GATAAGACTACTCCAGAGATAGCGTTAGGAATGATGGACGACTTTGTCACCCCACCTGAT GAAGTTAAACCTTACTCCTATGTGGCAGTGGCATCAGGCTCTAAAAGACACAATATGGCC AAGATATATGCGGGTTTTTACAAATATGACGATTCTACAATTCCACCAGAAAATCAACAA CGTGTCCCAATCATTACAATTGTGAAGTGCGGTACTCCTGCAGAGCAGGGGGCCGCCAAA CCCGGTAACAGAGGTAAGCGTGATTCTCAAATTATTCTGATGTCCTTTTTAGAAAAAATA ACATTTGATGAAAGAATGACTCAATTGGAATTTCAGCTTTTAAAAAATATTTGGCAGATT ACGGGGCTAATGGCAGACTTCTACGAAACGGTACTTATGGTTGATGCTGATACTAAAGTC TTTCCCGATGCTTTAACTCATATGGTCGCTGAAATGGTTAAAGATCCTTTGATTATGGGT CTTTGTGGTGAGACCAAGATCGCTAATAAGGCACAATCTTGGGTAACTGCAATTCAAGTG TTTGAGTACTATATTTCGCATCATCAGGCTAAAGCTTTTGAATCTGTCTTCGGTTCGGTA ACTTGTTTGCCGGGATGTTTCTCAATGTATCGTATAAAATCTCCTAAAGGTTCAGATGGT TATTGGGTACCTGTATTGGCAAATCCAGATATTGTTGAAAGATATTCGGATAATGTCACA AACACTTTGCATAAGAAGAACTTATTATTACTTGGTGAAGATAGATTTTTATCTTCATTA ATGTTAAAGACTTTCCCTAAGAGAAAGCAAGTATTTGTTCCAAAAGCTGCTTGTAAAACT ATTGCCCCTGATAAATTCAAAGTCTTACTTTCCCAGCGTCGAAGATGGATTAATTCTACG GTACATAACCTTTTTGAATTAGTTCTAATCAGAGACTTATGTGGCACTTTCTGTTTTTCC ATGCAATTTGTGATTGGTATTGAATTGATTGGTACTATGGTACTGCCGTTAGCCATTTGC TTTACTATTTATGTCATTATTTTTGCCATTGTATCAAAACCTACACCCGTAATCACTTTA GTTTTACTGGCAATTATTCTTGGTCTGCCCGGCTTAATTGTTGTTATAACTGCTACGAGA TGGTCGTACCTATGGTGGATGTGCGTATATATTTGTGCTTTGCCTATTTGGAATTTCGTA CTACCTTCATATGCGTACTGGAAATTTGATGACTTCTCATGGGGTGATACGAGAACTATT GCGGGAGGTAATAAAAAGGCACAAGACGAGAATGAAGGTGAATTTGATCACTCAAAGATT AAAATGAGGACATGGAGGGAATTTGAAAGGGAAGATATTCTCAATCGGAAGGAGGAAAGT GACTCCTTAGTTGCATAG
Protein Properties
Pfam Domain Function
Protein Residues1165
Protein Molecular Weight131600.0
Protein Theoretical pI6.69
Signalling Regions
  • None
Transmembrane Regions
  • 171-191
  • 203-223
  • 453-473
  • 1007-1027
  • 1030-1050
  • 1056-1076
  • 1081-1101
Protein Sequence>Chitin synthase 3 MTGLNGDDPDDYYLNLNQDEESLLRSRHSVGSGAPHRQGSLVRPERSRLNNPDNPHFYYA QKTQEQMNHLDVLPSSTGVNPNATRRSGSLRSKGSVRSKFSGRETDSYLLQDMNTTDKKA SVKISDEGVAEDEFDKDGDVDNFEESSTQPINKSIKPLRKETNDTLSFWQMYCYFITFWA PAPILAFCGMPKKERQMAWREKVALISVILYIGAIVAFLTFGFTKTVCSSSKLRLKNNEV STEFVVINGKAYELDTSSRSGIQDVEVDSDTLYGPWSDAGKDASFLFQNVNGNCHNLITP KSNSSIPHDDDNNLAWYFPCKLKNQDGSSKPNFTVENYAGWNCHTSKEDRDAFYGLKSKA DVYFTWDGIKNSSRNLIVYNGDVLDLDLLDWLEKDDVDYPVVFDDLKTSNLQGYDLSLVL SNGHERKIARCLSEIIKVGEVDSKTVGCIASDVVLYVSLVFILSVVIIKFIIACYFRWTV ARKQGAYIVDNKTMDKHTNDIEDWSNNIQTKAPLKEVDPHLRPKKYSKKSLGHKRASTFD LLKKHSSKMFQFNESVIDLDTSMSSSLQSSGSYRGMTTMTTQNAWKLSNENKAVHSRNPS TLLPTSSMFWNKATSSPVPGSSLIQSLDSTIIHPDIVQQPPLDFMPYGFPLIHTICFVTC YSEDEEGLRTTLDSLSTTDYPNSHKLLMVVCDGLIKGSGNDKTTPEIALGMMDDFVTPPD EVKPYSYVAVASGSKRHNMAKIYAGFYKYDDSTIPPENQQRVPIITIVKCGTPAEQGAAK PGNRGKRDSQIILMSFLEKITFDERMTQLEFQLLKNIWQITGLMADFYETVLMVDADTKV FPDALTHMVAEMVKDPLIMGLCGETKIANKAQSWVTAIQVFEYYISHHQAKAFESVFGSV TCLPGCFSMYRIKSPKGSDGYWVPVLANPDIVERYSDNVTNTLHKKNLLLLGEDRFLSSL MLKTFPKRKQVFVPKAACKTIAPDKFKVLLSQRRRWINSTVHNLFELVLIRDLCGTFCFS MQFVIGIELIGTMVLPLAICFTIYVIIFAIVSKPTPVITLVLLAIILGLPGLIVVITATR WSYLWWMCVYICALPIWNFVLPSYAYWKFDDFSWGDTRTIAGGNKKAQDENEGEFDHSKI KMRTWREFEREDILNRKEESDSFVA
References
External Links
ResourceLink
Saccharomyces Genome Database CHS3
Uniprot IDP29465
Uniprot NameCHS3_YEAST
GenBank Gene IDM73697
Genebank Protein ID172104
General Reference
  • Bulawa, C. E. (1992). "CSD2, CSD3, and CSD4, genes required for chitin synthesis in Saccharomyces cerevisiae: the CSD2 gene product is related to chitin synthases and to developmentally regulated proteins in Rhizobium species and Xenopus laevis." Mol Cell Biol 12:1764-1776.1532231
  • Smits, P. H., De Haan, M., Maat, C., Grivell, L. A. (1994). "The complete sequence of a 33 kb fragment on the right arm of chromosome II from Saccharomyces cerevisiae reveals 16 open reading frames, including ten new open reading frames, five previously identified genes and a homologue of the SCO1 gene." Yeast 10 Suppl A:S75-S80.8091864
  • Feldmann, H., Aigle, M., Aljinovic, G., Andre, B., Baclet, M. C., Barthe, C., Baur, A., Becam, A. M., Biteau, N., Boles, E., Brandt, T., Brendel, M., Bruckner, M., Bussereau, F., Christiansen, C., Contreras, R., Crouzet, M., Cziepluch, C., Demolis, N., Delaveau, T., Doignon, F., Domdey, H., Dusterhus, S., Dubois, E., Dujon, B., El Bakkoury, M., Entian, K. D., Feurmann, M., Fiers, W., Fobo, G. M., Fritz, C., Gassenhuber, H., Glandsdorff, N., Goffeau, A., Grivell, L. A., de Haan, M., Hein, C., Herbert, C. J., Hollenberg, C. P., Holmstrom, K., Jacq, C., Jacquet, M., Jauniaux, J. C., Jonniaux, J. L., Kallesoe, T., Kiesau, P., Kirchrath, L., Kotter, P., Korol, S., Liebl, S., Logghe, M., Lohan, A. J., Louis, E. J., Li, Z. Y., Maat, M. J., Mallet, L., Mannhaupt, G., Messenguy, F., Miosga, T., Molemans, F., Muller, S., Nasr, F., Obermaier, B., Perea, J., Pierard, A., Piravandi, E., Pohl, F. M., Pohl, T. M., Potier, S., Proft, M., Purnelle, B., Ramezani Rad, M., Rieger, M., Rose, M., Schaaff-Gerstenschlager, I., Scherens, B., Schwarzlose, C., Skala, J., Slonimski, P. P., Smits, P. H., Souciet, J. L., Steensma, H. Y., Stucka, R., Urrestarazu, A., van der Aart, Q. J., van Dyck, L., Vassarotti, A., Vetter, I., Vierendeels, F., Vissers, S., Wagner, G., de Wergifosse, P., Wolfe, K. H., Zagulski, M., Zimmermann, F. K., Mewes, H. W., Kleine, K. (1994). "Complete DNA sequence of yeast chromosome II." EMBO J 13:5795-5809.7813418
  • Valdivieso, M. H., Mol, P. C., Shaw, J. A., Cabib, E., Duran, A. (1991). "CAL1, a gene required for activity of chitin synthase 3 in Saccharomyces cerevisiae." J Cell Biol 114:101-109.2050737
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Peng, J., Schwartz, D., Elias, J. E., Thoreen, C. C., Cheng, D., Marsischky, G., Roelofs, J., Finley, D., Gygi, S. P. (2003). "A proteomics approach to understanding protein ubiquitination." Nat Biotechnol 21:921-926.12872131
  • Kim, H., Melen, K., Osterberg, M., von Heijne, G. (2006). "A global topology map of the Saccharomyces cerevisiae membrane proteome." Proc Natl Acad Sci U S A 103:11142-11147.16847258
  • Li, X., Gerber, S. A., Rudner, A. D., Beausoleil, S. A., Haas, W., Villen, J., Elias, J. E., Gygi, S. P. (2007). "Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae." J Proteome Res 6:1190-1197.17330950
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956