You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NamePorphobilinogen deaminase
Synonyms
  • PBG
  • Hydroxymethylbilane synthase
  • HMBS
  • Pre-uroporphyrinogen synthase
Gene NameHEM3
Enzyme Class
Biological Properties
General FunctionInvolved in hydroxymethylbilane synthase activity
Specific FunctionTetrapolymerization of the monopyrrole PBG into the hydroxymethylbilane pre-uroporphyrinogen in several discrete steps
Cellular LocationNot Available
SMPDB PathwaysNot Available
KEGG Pathways
Porphyrin and chlorophyll metabolismec00860 Map00860
SMPDB ReactionsNot Available
KEGG Reactions
Porphobilinogen + waterAmmonium + Hydroxymethylbilane
Metabolites
YMDB IDNameView
YMDB00091AmmoniaShow
YMDB00145HydroxymethylbilaneShow
YMDB00401PorphobilinogenShow
YMDB00423AmmoniumShow
YMDB00890waterShow
GO Classification
Component
Not Available
Function
hydroxymethylbilane synthase activity
catalytic activity
transferase activity, transferring alkyl or aryl (other than methyl) groups
transferase activity
Process
macromolecule modification
peptidyl-pyrromethane cofactor linkage
protein modification process
biosynthetic process
cellular biosynthetic process
heterocycle biosynthetic process
tetrapyrrole biosynthetic process
post-translational protein modification
metabolic process
protein-cofactor linkage
macromolecule metabolic process
Gene Properties
Chromosome Locationchromosome 4
LocusYDL205C
Gene Sequence>984 bp ATGGGCCCTGAAACTCTACATATTGGTGGGAGAAAATCGAAATTGGCGGTAATACAATCC AACCATGTTTTAAAACTGATCGAAGAAAAGTATCCGGACTACGACTGCAAGGTTTTCACT TTGCAAACTCTTGGTGACCAGATTCAATTCAAACCTTTGTACTCATTTGGCGGTAAAGCT TTATGGACAAAGGAGTTGGAAGACCATCTTTACCATGACGATCCCTCAAAGAAGCTTGAC TTGATCGTTCATTCTCTGAAGGACATGCCCACTTTACTACCAGAGGGTTTCGAGCTGGGG GGTATCACTAAGCGGGTCGATCCAACAGATTGTCTTGTCATGCCCTTTTACTCTGCTTAT AAGTCTCTGGATGACCTTCCAGACGGGGGGATTGTGGGAACCTCATCCGTGAGAAGATCT GCTCAGCTAAAAAGAAAATACCCACATTTGAAATTTGAAAGTGTCAGAGGAAATATACAA ACTAGATTACAAAAACTAGACGACCCAAAATCTCCGTACCAATGCATCATCTTGGCGTCT GCTGGGTTGATGCGTATGGGGTTGGAAAACAGAATTACGCAGCGATTCCATTCGGATACA ATGTACCATGCAGTTGGACAAGGCGCCCTGGGTATAGAAATTAGAAAGGGTGACACCAAG ATGATGAAGATTCTTGACGAAATTTGCGATCTAAATGCAACTATATGTTGCCTTTCGGAG CGTGCTTTGATGAGAACTTTAGAGGGGGGTTGTTCCGTTCCTATTGGTGTGGAATCTAAA TACAATGAAGAGACTAAAAAATTACTATTAAAGGCCATTGTAGTTGACGTTGAAGGCACA GAAGCAGTAGAAGACGAAATTGAAATGCTAATAGAAAATGTTAAAGAAGATTCCATGGCG TGTGGTAAGATACTAGCTGAAAGAATGATTGCCGATGGCGCAAAGAAAATTCTGGATGAA ATTAATTTAGACAGAATCAAATGA
Protein Properties
Pfam Domain Function
Protein Residues327
Protein Molecular Weight36674.19922
Protein Theoretical pI6.32
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Porphobilinogen deaminase MGPETLHIGGRKSKLAVIQSNHVLKLIEEKYPDYDCKVFTLQTLGDQIQFKPLYSFGGKA LWTKELEDHLYHDDPSKKLDLIVHSLKDMPTLLPEGFELGGITKRVDPTDCLVMPFYSAY KSLDDLPDGGIVGTSSVRRSAQLKRKYPHLKFESVRGNIQTRLQKLDDPKSPYQCIILAS AGLMRMGLENRITQRFHSDTMYHAVGQGALGIEIRKGDTKMMKILDEICDLNATICCLSE RALMRTLEGGCSVPIGVESKYNEETKKLLLKAIVVDVEGTEAVEDEIEMLIENVKEDSMA CGKILAERMIADGAKKILDEINLDRIK
References
External Links
ResourceLink
Saccharomyces Genome Database HEM3
Uniprot IDP28789
Uniprot NameHEM3_YEAST
GenBank Gene IDX99000
Genebank Protein ID1429351
General Reference
  • Keng, T., Richard, C., Larocque, R. (1992). "Structure and regulation of yeast HEM3, the gene for porphobilinogen deaminase." Mol Gen Genet 234:233-243.1508149
  • Jacq, C., Alt-Morbe, J., Andre, B., Arnold, W., Bahr, A., Ballesta, J. P., Bargues, M., Baron, L., Becker, A., Biteau, N., Blocker, H., Blugeon, C., Boskovic, J., Brandt, P., Bruckner, M., Buitrago, M. J., Coster, F., Delaveau, T., del Rey, F., Dujon, B., Eide, L. G., Garcia-Cantalejo, J. M., Goffeau, A., Gomez-Peris, A., Zaccaria, P., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV." Nature 387:75-78.9169867
  • Zhang, Z., Dietrich, F. S. (2005). "Mapping of transcription start sites in Saccharomyces cerevisiae using 5' SAGE." Nucleic Acids Res 33:2838-2851.15905473
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106