You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameChorismate synthase
Synonyms
  • 5-enolpyruvylshikimate-3-phosphate phospholyase
Gene NameARO2
Enzyme Class
Biological Properties
General FunctionInvolved in chorismate synthase activity
Specific Function5-O-(1-carboxyvinyl)-3-phosphoshikimate = chorismate + phosphate
Cellular LocationNot Available
SMPDB PathwaysNot Available
KEGG Pathways
Phenylalanine, tyrosine and tryptophan biosynthesisec00400 Map00400
SMPDB ReactionsNot Available
KEGG Reactions
5-O-(1-carboxyvinyl)-3-phosphoshikimic acidChorismate + phosphate
Metabolites
YMDB IDNameView
YMDB00148ChorismateShow
YMDB003615-O-(1-carboxyvinyl)-3-phosphoshikimic acidShow
YMDB00907phosphateShow
GO Classification
Component
Not Available
Function
catalytic activity
chorismate synthase activity
lyase activity
carbon-oxygen lyase activity
carbon-oxygen lyase activity, acting on phosphates
Process
aromatic amino acid family biosynthetic process
metabolic process
cellular metabolic process
cellular amino acid and derivative metabolic process
cellular amino acid metabolic process
cellular amino acid biosynthetic process
Gene Properties
Chromosome Locationchromosome 7
LocusYGL148W
Gene Sequence>1131 bp ATGTCAACGTTTGGGAAACTGTTCCGCGTCACCACATATGGTGAATCGCATTGTAAGTCT GTCGGTTGCATTGTCGACGGTGTTCCTCCAGGAATGTCATTAACCGAAGCTGACATTCAG CCACAATTGACCAGAAGAAGACCGGGTCAATCTAAGCTATCGACCCCTAGAGACGAAAAG GATAGAGTGGAAATCCAGTCCGGTACCGAGTTCGGCAAGACTCTAGGTACACCCATCGCC ATGATGATCAAAAACGAGGACCAAAGACCTCACGACTACTCCGACATGGACAAGTTCCCT AGACCTTCCCATGCGGACTTCACGTACTCGGAAAAGTACGGTATCAAGGCCTCCTCTGGT GGTGGCAGAGCTTCTGCTAGAGAAACGATTGGCCGTGTCGCTTCAGGTGCCATTGCTGAG AAGTTCTTAGCTCAGAACTCTAATGTCGAGATCGTAGCCTTTGTGACACAAATCGGGGAA ATCAAGATGAACAGAGACTCTTTCGATCCTGAATTTCAGCATCTGTTGAACACCATCACC AGGGAAAAAGTGGACTCAATGGGTCCTATCAGATGTCCAGACGCCTCCGTTGCTGGTTTG ATGGTCAAGGAAATCGAAAAGTACAGAGGCAACAAGGACTCTATCGGTGGTGTCGTCACT TGTGTCGTGAGAAACTTGCCTACCGGTCTCGGTGAGCCATGCTTTGACAAGTTGGAAGCC ATGTTGGCTCATGCTATGTTGTCCATTCCAGCATCCAAGGGTTTCGAAATTGGCTCAGGT TTTCAGGGTGTCTCTGTTCCAGGGTCCAAGCACAATGACCCATTTTACTTTGAAAAAGAA ACAAACAGATTAAGAACAAAGACCAACAATTCAGGTGGTGTACAAGGTGGTATCTCTAAT GGTGAGAACATCTATTTCTCTGTCCCATTCAAGTCAGTGGCCACTATCTCTCAAGAACAA AAAACCGCCACTTACGATGGTGAAGAAGGTATCTTAGCCGCTAAGGGTAGACATGACCCT GCTGTCACTCCAAGAGCTATTCCTATTGTGGAAGCCATGACCGCTCTGGTGTTGGCTGAC GCGCTTTTGATCCAAAAGGCAAGAGATTTCTCCAGATCCGTGGTTCATTAA
Protein Properties
Pfam Domain Function
Protein Residues376
Protein Molecular Weight40838.0
Protein Theoretical pI7.92
PDB Fileshow
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Chorismate synthase MSTFGKLFRVTTYGESHCKSVGCIVDGVPPGMSLTEADIQPQLTRRRPGQSKLSTPRDEK DRVEIQSGTEFGKTLGTPIAMMIKNEDQRPHDYSDMDKFPRPSHADFTYSEKYGIKASSG GGRASARETIGRVASGAIAEKFLAQNSNVEIVAFVTQIGEIKMNRDSFDPEFQHLLNTIT REKVDSMGPIRCPDASVAGLMVKEIEKYRGNKDSIGGVVTCVVRNLPTGLGEPCFDKLEA MLAHAMLSIPASKGFEIGSGFQGVSVPGSKHNDPFYFEKETNRLRTKTNNSGGVQGGISN GENIYFSVPFKSVATISQEQKTATYDGEEGILAAKGRHDPAVTPRAIPIVEAMTALVLAD ALLIQKARDFSRSVVH
References
External Links
ResourceLink
Saccharomyces Genome Database ARO2
Uniprot IDP28777
Uniprot NameAROC_YEAST
GenBank Gene IDX60190
Genebank Protein ID3387
PDB ID
1R53
General Reference
  • Jones, D. G., Reusser, U., Braus, G. H. (1991). "Molecular cloning, characterization and analysis of the regulation of the ARO2 gene, encoding chorismate synthase, of Saccharomyces cerevisiae." Mol Microbiol 5:2143-2152.1837329
  • Voet, M., Defoor, E., Verhasselt, P., Riles, L., Robben, J., Volckaert, G. (1997). "The sequence of a nearly unclonable 22.8 kb segment on the left arm chromosome VII from Saccharomyces cerevisiae reveals ARO2, RPL9A, TIP1, MRF1 genes and six new open reading frames." Yeast 13:177-182.9046099
  • Tettelin, H., Agostoni Carbone, M. L., Albermann, K., Albers, M., Arroyo, J., Backes, U., Barreiros, T., Bertani, I., Bjourson, A. J., Bruckner, M., Bruschi, C. V., Carignani, G., Castagnoli, L., Cerdan, E., Clemente, M. L., Coblenz, A., Coglievina, M., Coissac, E., Defoor, E., Del Bino, S., Delius, H., Delneri, D., de Wergifosse, P., Dujon, B., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome VII." Nature 387:81-84.9169869
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956