Canmetcon
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameSphingosine N-acyltransferase LAC1
SynonymsNot Available
Gene NameLAC1
Enzyme Class
Biological Properties
General FunctionInvolved in identical protein binding
Specific FunctionComponent of the ceramide synthase complex required for C26-CoA-dependent ceramide synthesis. Redundant with LAG1. Facilitates ER-to-Golgi transport of GPI-anchored proteins
Cellular LocationEndoplasmic reticulum membrane; Multi-pass membrane protein
SMPDB Pathways
Sphingolipid metabolismPW002479 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Sphingolipid metabolismec00600 Map00600
SMPDB Reactions
Succinyl-CoA + SphinganineDihydroceramide + Coenzyme A
KEGG Reactions
Sphinganine + Tetracosanoyl-CoA N-tetracosanoylsphinganine + hydron + Coenzyme A
Sphinganine + hexacosanoyl-CoAN-hexacosanylsphinganine + hydron + Coenzyme A
Phytosphingosine + Tetracosanoyl-CoA N-Tetracosanoylphytosphingosine + hydron + Coenzyme A
Phytosphingosine + hexacosanoyl-CoAN-Hexacosanoylphytosphingosine + hydron + Coenzyme A
Metabolites
YMDB IDNameView
YMDB00045Coenzyme AShow
YMDB00190SphingosineShow
YMDB00285PhytosphingosineShow
YMDB00327SphinganineShow
YMDB00514Succinyl-CoAShow
YMDB00537hexacosanoyl-CoAShow
YMDB00619N-tetracosanoylsphinganineShow
YMDB00621N-hexacosanylsphinganineShow
YMDB00862hydronShow
YMDB00909Tetracosanoyl-CoA Show
YMDB00963N-TetracosanoylphytosphingosineShow
YMDB00964N-HexacosanoylphytosphingosineShow
YMDB16188DihydroceramideShow
GO Classification
Component
membrane part
intrinsic to membrane
integral to membrane
cell part
Function
Not Available
Process
Not Available
Gene Properties
Chromosome Locationchromosome 11
LocusYKL008C
Gene Sequence>1257 bp ATGTCGACAATAAAGCCAAGCCCTTCAAACAACAATTTGAAAGTGAGGTCAAGACCAAGA CGCAAGTCTTCCATAGGTAAGATCGACCTCGGGGACACTGTACCTAGTTTAGGTACTATG TTCGAGACAAAAGAATCTAAAACGGCTGCTAAAAGGCGTATGCAGAGATTATCTGAAGCC ACCAAAAATGATAGCGACCTGGTCAAGAAAATCTGGTTTTCATTCCGAGAGATAAGTTAC CGTCATGCCTGGATAGCTCCCTTGATGATTTTAATCGCGGTATATAGTGCCTATTTCACT TCTGGTAACACTACAAAGACAAATGTGTTACATAGATTTGTCGCTGTGTCATACCAAATA GGTGATACCAACGCATATGGTAAAGGTATTAACGATTTGTGCTTTGTATTTTACTATATG ATTTTTTTCACATTCTTACGTGAATTCCTAATGGATGTTGTCATTAGACCGTTCGCTATT AGGTTACACGTCACTTCTAAGCACAGAATAAAAAGAATCATGGAACAAATGTACGCTATT TTCTACACCGGTGTTTCCGGTCCTTTCGGGATATATTGTATGTACCATTCGGATTTATGG TTTTTCAACACAAAGGCAATGTACAGAACATATCCAGATTTCACTAATCCCTTCTTATTC AAGGTATTCTATTTGGGTCAAGCTGCATTTTGGGCTCAACAAGCCTGCATTCTTGTATTG CAACTAGAAAAGCCAAGAAAAGATCATAACGAGTTGACTTTCCATCATATTGTTACTTTA CTATTGATTTGGTCTTCCTACGTATTTCATTTCACTAAAATGGGACTGCCAATCTATATC ACAATGGATGTTTCTGATTTTCTTTTGTCATTCTCCAAAACTCTAAATTATTTGGACTCT GGATTGGCTTTTTTTTCTTTTGCTATCTTTGTTGTTGCGTGGATTTATTTGCGTCATTAC ATAAATTTAAAGATCCTATGGTCCGTTTTAACGCAATTTCGCACGGAAGGTAACTATGTC TTGAATTTTGCCACTCAGCAATATAAATGTTGGATTTCCTTACCAATTGTCTTTGTATTG ATAGGCGCTTTGCAATTAGTGAATCTTTATTGGCTGTTCCTTATTTTTAGAGTTCTTTAC AGGATTCTATGGAGAGGTATTCTCAAGGATGACAGAAGTGATAGTGAATCAGACGAAGAA AGTGATGAAAGTTCCACTACTCCAACTGACAGTACTCCAACGAAAAAGGATATTTGA
Protein Properties
Pfam Domain Function
Protein Residues418
Protein Molecular Weight48991.60156
Protein Theoretical pI9.81
Signalling Regions
  • None
Transmembrane Regions
  • 82-102
  • 135-155
  • 173-193
  • 222-242
  • 260-280
  • 297-317
  • 356-376
Protein Sequence>Sphingosine N-acyltransferase LAC1 MSTIKPSPSNNNLKVRSRPRRKSSIGKIDLGDTVPSLGTMFETKESKTAAKRRMQRLSEA TKNDSDLVKKIWFSFREISYRHAWIAPLMILIAVYSAYFTSGNTTKTNVLHRFVAVSYQI GDTNAYGKGINDLCFVFYYMIFFTFLREFLMDVVIRPFAIRLHVTSKHRIKRIMEQMYAI FYTGVSGPFGIYCMYHSDLWFFNTKAMYRTYPDFTNPFLFKVFYLGQAAFWAQQACILVL QLEKPRKDHNELTFHHIVTLLLIWSSYVFHFTKMGLPIYITMDVSDFLLSFSKTLNYLDS GLAFFSFAIFVVAWIYLRHYINLKILWSVLTQFRTEGNYVLNFATQQYKCWISLPIVFVL IGALQLVNLYWLFLIFRVLYRILWRGILKDDRSDSESDEESDESSTTPTDSTPTKKDI
References
External Links
ResourceLink
Saccharomyces Genome Database LAC1
Uniprot IDP28496
Uniprot NameLAC1_YEAST
GenBank Gene IDZ28008
Genebank Protein ID485983
General Reference
  • Boyer, J., Pascolo, S., Richard, G. F., Dujon, B. (1993). "Sequence of a 7.8 kb segment on the left arm of yeast chromosome XI reveals four open reading frames, including the CAP1 gene, an intron-containing gene and a gene encoding a homolog to the mammalian UOG-1 gene." Yeast 9:279-287.8488728
  • Dujon, B., Alexandraki, D., Andre, B., Ansorge, W., Baladron, V., Ballesta, J. P., Banrevi, A., Bolle, P. A., Bolotin-Fukuhara, M., Bossier, P., et, a. l. .. (1994). "Complete DNA sequence of yeast chromosome XI." Nature 369:371-378.8196765
  • Amatruda, J. F., Gattermeir, D. J., Karpova, T. S., Cooper, J. A. (1992). "Effects of null mutations and overexpression of capping protein on morphogenesis, actin distribution and polarized secretion in yeast." J Cell Biol 119:1151-1162.1447293
  • Barz, W. P., Walter, P. (1999). "Two endoplasmic reticulum (ER) membrane proteins that facilitate ER-to-Golgi transport of glycosylphosphatidylinositol-anchored proteins." Mol Biol Cell 10:1043-1059.10198056
  • Guillas, I., Kirchman, P. A., Chuard, R., Pfefferli, M., Jiang, J. C., Jazwinski, S. M., Conzelmann, A. (2001). "C26-CoA-dependent ceramide synthesis of Saccharomyces cerevisiae is operated by Lag1p and Lac1p." EMBO J 20:2655-2665.11387200
  • Schorling, S., Vallee, B., Barz, W. P., Riezman, H., Oesterhelt, D. (2001). "Lag1p and Lac1p are essential for the Acyl-CoA-dependent ceramide synthase reaction in Saccharomyces cerevisae." Mol Biol Cell 12:3417-3427.11694577
  • Winter, E., Ponting, C. P. (2002). "TRAM, LAG1 and CLN8: members of a novel family of lipid-sensing domains?" Trends Biochem Sci 27:381-383.12151215
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Kolaczkowski, M., Kolaczkowska, A., Gaigg, B., Schneiter, R., Moye-Rowley, W. S. (2004). "Differential regulation of ceramide synthase components LAC1 and LAG1 in Saccharomyces cerevisiae." Eukaryot Cell 3:880-892.15302821
  • Vallee, B., Riezman, H. (2005). "Lip1p: a novel subunit of acyl-CoA ceramide synthase." EMBO J 24:730-741.15692566
  • Kageyama-Yahara, N., Riezman, H. (2006). "Transmembrane topology of ceramide synthase in yeast." Biochem J 398:585-593.16756512
  • Kim, H., Melen, K., Osterberg, M., von Heijne, G. (2006). "A global topology map of the Saccharomyces cerevisiae membrane proteome." Proc Natl Acad Sci U S A 103:11142-11147.16847258