You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameMonoglyceride lipase
Synonyms
  • MGL
  • Monoacylglycerol hydrolase
  • Monoacylglycerol lipase
  • Serine hydrolase YJU3
  • MAG hydrolase
  • MGH
  • MAG lipase
  • MAGL
Gene NameYJU3
Enzyme ClassNot Available
Biological Properties
General Functiontriglyceride metabolic process
Specific FunctionConverts monoacylglycerides (MAG) to free fatty acids and glycerol. Required for efficient degradation of MAG, short-lived intermediates of glycerolipid metabolism which may also function as lipid signaling molecules. Controls inactivation of the signaling lipid N-palmitoylethanolamine (PEA).
Cellular LocationNot Available
SMPDB Pathways
Triacylglycerol metabolismPW002695 ThumbThumb?image type=greyscaleThumb?image type=simple
Triacylglycerol metabolism TG(10:0/10:0/10:0)PW007514 ThumbThumb?image type=greyscaleThumb?image type=simple
Triacylglycerol metabolism TG(10:0/10:0/12:0)PW007575 ThumbThumb?image type=greyscaleThumb?image type=simple
Triacylglycerol metabolism TG(10:0/10:0/14:0)PW007576 ThumbThumb?image type=greyscaleThumb?image type=simple
Triacylglycerol metabolism TG(10:0/10:0/14:1(9Z))PW007578 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG PathwaysNot Available
SMPDB Reactions
MG(16:0/0:0/0:0) + waterPalmitic acid + hydron + Glycerol
MG(10:0/0:0/0:0) + waterPalmitic acid + hydron + Glycerol
MG(12:0/0:0/0:0) + waterPalmitic acid + hydron + Glycerol
MG(14:0/0:0/0:0) + waterPalmitic acid + hydron + Glycerol
MG(15:0/0:0/0:0) + waterPalmitic acid + hydron + Glycerol
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00069Palmitic acidShow
YMDB00283GlycerolShow
YMDB00862hydronShow
YMDB00890waterShow
YMDB16219MG(14:1(9Z)/0:0/0:0)Show
YMDB16220MG(16:1(9Z)/0:0/0:0)Show
YMDB16221MG(18:1(9Z)/0:0/0:0)Show
YMDB16222MG(22:1(13Z)/0:0/0:0)Show
YMDB16223MG(24:1(15Z)/0:0/0:0)Show
GO Classification
Function
mitochondrial outer membrane
acylglycerol lipase activity
regulation of signal transduction
triglyceride catabolic process
triglyceride metabolic process
endoplasmic reticulum
membrane
lipid particle
Gene Properties
Chromosome LocationNot Available
Locus
Gene Sequence>942 bp ATGGCTCCGTATCCATACAAAGTGCAGACGACAGTACCTGAACTTCAATACGAAAACTTT GATGGTGCTAAGTTCGGGTACATGTTCTGGCCTGTTCAAAATGGCACCAATGAGGTCAGA GGTAGAGTTTTACTGATTCATGGGTTTGGCGAGTACACAAAGATTCAATTCCGGCTTATG GACCACTTATCACTCAATGGTTACGAGTCATTTACGTTTGATCAAAGGGGTGCTGGTGTT ACATCGCCGGGCAGATCGAAAGGTGTAACTGATGAGTACCATGTGTTTAACGATCTTGAG CATTTTGTGGAGAAGAACTTGAGTGAATGTAAGGCCAAAGGCATACCCTTGTTCATGTGG GGGCATTCAATGGGCGGTGGTATCTGCCTAAACTATGCCTGCCAAGGTAAGCACAAAAAC GAAATAAGCGGATATATCGGGTCAGGCCCATTAATAATTTTACATCCGCATACAATGTAT AACAAGCCGACCCAAATTATTGCTCCATTATTGGCGAAATTTTTACCAAGGGTAAGGATC GACACTGGTTTAGATCTTAAAGGAATCACATCTGATAAAGCCTATCGTGCTTTCCTCGGA AGCGATCCTATGTCTGTTCCACTATATGGGTCGTTTAGGCAAATACACGACTTTATGCAA CGTGGTGCCAAGCTCTACAAGAATGAAAACAATTATATTCAGAAGAACTTCGCTAAAGAC AAACCCGTTATTATTATGCATGGACAAGACGACACAATCAACGATCCTAAGGGCTCTGAA AAGTTCATTCAGGACTGTCCTTCTGCTGACAAAGAATTAAAGCTGTATCCGGGCGCAAGA CATTCGATTTTCTCACTAGAGACAGATAAAGTCTTCAACACGGTGTTCAATGATATGAAG CAATGGTTGGACAAACACACCACGACCGAAGCTAAACCATAA
Protein Properties
Pfam Domain FunctionNot Available
Protein Residues313
Protein Molecular Weight35562.4
Protein Theoretical pINot Available
PDB Fileshow
Signalling RegionsNot Available
Transmembrane RegionsNot Available
Protein Sequence>Monoglyceride lipase MAPYPYKVQTTVPELQYENFDGAKFGYMFWPVQNGTNEVRGRVLLIHGFGEYTKIQFRLM DHLSLNGYESFTFDQRGAGVTSPGRSKGVTDEYHVFNDLEHFVEKNLSECKAKGIPLFMW GHSMGGGICLNYACQGKHKNEISGYIGSGPLIILHPHTMYNKPTQIIAPLLAKFLPRVRI DTGLDLKGITSDKAYRAFLGSDPMSVPLYGSFRQIHDFMQRGAKLYKNENNYIQKNFAKD KPVIIMHGQDDTINDPKGSEKFIQDCPSADKELKLYPGARHSIFSLETDKVFNTVFNDMK QWLDKHTTTEAKP
References
External Links
ResourceLink
Saccharomyces Genome Database YJU3
Uniprot IDP28321
Uniprot NameYJU3
PDB ID
4ZWN
General ReferenceNot Available