You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameCTP synthase 1
Synonyms
  • CTP synthetase 1
  • UTP--ammonia ligase 1
Gene NameURA7
Enzyme Class
Biological Properties
General FunctionInvolved in CTP synthase activity
Specific FunctionCatalyzes the ATP-dependent amination of UTP to CTP with either L-glutamine or ammonia as the source of nitrogen
Cellular LocationNot Available
SMPDB Pathways
Pyrimidine metabolismPW002469 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Pyrimidine metabolismec00240 Map00240
SMPDB ReactionsNot Available
KEGG Reactions
Uridine triphosphate + Adenosine triphosphate + water + L-Glutaminephosphate + L-Glutamic acid + hydron + ADP + Cytidine triphosphate
Uridine triphosphate + Adenosine triphosphate + Ammoniumphosphate + hydron + ADP + Cytidine triphosphate
Metabolites
YMDB IDNameView
YMDB00002L-GlutamineShow
YMDB00091AmmoniaShow
YMDB00109Adenosine triphosphateShow
YMDB00271L-Glutamic acidShow
YMDB00279Cytidine triphosphateShow
YMDB00326Uridine triphosphateShow
YMDB00423AmmoniumShow
YMDB00862hydronShow
YMDB00890waterShow
YMDB00907phosphateShow
YMDB00914ADPShow
GO Classification
Component
Not Available
Function
ligase activity, forming carbon-nitrogen bonds
catalytic activity
CTP synthase activity
ligase activity
Process
nitrogen compound metabolic process
cellular nitrogen compound metabolic process
nucleobase, nucleoside, nucleotide and nucleic acid metabolic process
nucleobase, nucleoside and nucleotide metabolic process
nucleoside phosphate metabolic process
nucleotide metabolic process
metabolic process
pyrimidine nucleotide metabolic process
pyrimidine nucleotide biosynthetic process
Gene Properties
Chromosome Locationchromosome 2
LocusYBL039C
Gene Sequence>1740 bp ATGAAGTACGTTGTTGTTTCAGGTGGTGTCATTTCGGGTATCGGTAAAGGTGTTCTTGCA TCTTCAACTGGTATGCTAATGAAAACCCTCGGTTTAAAGGTTACGTCAATTAAAATTGAC CCTTATATGAACATTGATGCAGGTACTATGTCTCCTTTGGAACATGGTGAATGTTTCGTG CTTGACGACGGTGGTGAAACAGATTTGGACTTGGGTAACTACGAGAGATACCTTGGAGTT ACTTTGACTAAAGATCATAACATTACTACTGGTAAAATATACTCGCACGTTATTGCTAAG GAAAGAAAAGGTGACTATTTAGGCAAAACCGTGCAAATTGTCCCTCATTTGACCAACGCT ATCCAAGATTGGATTGAGCGCGTGGCCAAAATTCCTGTAGATGACACCGGTATGGAACCA GATGTTTGTATCATTGAATTGGGTGGGACAGTTGGTGACATTGAAAGTGCTCCTTTTGTG GAGGCACTAAGACAATTCCAATTTAAAGTTGGAAAGGAAAATTTTGCCTTGATACACGTT TCTCTAGTTCCTGTCATCCACGGTGAACAAAAAACTAAGCCAACTCAAGCTGCCATCAAA GGTTTGAGGTCTCTTGGTTTAGTTCCAGATATGATCGCCTGTAGATGTAGTGAAACTTTG GATAAACCAACAATCGATAAGATTGCCATGTTTTGTCATGTGGGGCCTGAACAGGTGGTT AACGTTCACGATGTTAATTCTACTTATCACGTCCCATTGTTGCTACTGGAACAAAAGATG ATTGATTACTTACACGCCAGATTAAAGTTAGATGAAATATCACTTACAGAAGAAGAAAAA CAAAGAGGCCTGGAATTATTGTCTAAATGGAAGGCCACAACAGGTAACTTCGATGAATCC ATGGAAACAGTGAAGATTCGTTTGGTTGGGAAATACACCAACTTGAAAGATTCTTATCTA TCAGTGATAAAAGCATTGGAACATTCATCCATGAAGTGTCGTCGTAAGTTAGACATTAAA TGGGTGGAAGCTACTGATTTGGAACCTGAAGCACAAGAAAGCAACAAAACTAAATTTCAT GAAGCATGGAACATGGTCAGTACCGCAGACGGTATCTTAATCCCCGGTGGTTTTGGTGTT AGAGGTACTGAAGGTATGGTTTTGGCTGCTAGATGGGCTCGTGAAAATCACATTCCATTC TTAGGGGTTTGCCTGGGTTTACAAATTGCCACCATTGAATTTACACGTAGTTCGTTGGGA AGAAAAGACAGTCATTCGGCAGAATTTTATCCAGACATTGATGAAAAAAATCACGTTGTC GTTTTCATGCCTGAAATTGACAAGGAAACCATGGGGGGCTCAATGAGATTAGGTTTGAGA CCAACATTTTTCCAAAATGAAACTGAATGGAGTCAAATCAAGAAGTTATACGGTGACGTC TCCGAAGTCCATGAAAGACACCGTCACCGTTACGAAATCAATCCAAAGATGGTTGATGAA TTGGAAAACAACGGGTTGATCTTTGTAGGTAAGGACGACACTGGAAAGCGTTGTGAGATT TTGGAATTAAAGAATCACCCATACTATATTGCTACTCAATATCACCCAGAATACACATCA AAGGTCTTAGATCCATCCAAACCATTTTTGGGTTTAGTTGCTGCTTCCGCTGGTATCCTT CAAGATGTCATTGAAGGTAAGTACGATCTTGAGGCCGGCGAAAACAAATTCAACTTTTAA
Protein Properties
Pfam Domain Function
Protein Residues579
Protein Molecular Weight64709.80078
Protein Theoretical pI5.91
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>CTP synthase 1 MKYVVVSGGVISGIGKGVLASSTGMLMKTLGLKVTSIKIDPYMNIDAGTMSPLEHGECFV LDDGGETDLDLGNYERYLGVTLTKDHNITTGKIYSHVIAKERKGDYLGKTVQIVPHLTNA IQDWIERVAKIPVDDTGMEPDVCIIELGGTVGDIESAPFVEALRQFQFKVGKENFALIHV SLVPVIHGEQKTKPTQAAIKGLRSLGLVPDMIACRCSETLDKPTIDKIAMFCHVGPEQVV NVHDVNSTYHVPLLLLEQKMIDYLHARLKLDEISLTEEEKQRGLELLSKWKATTGNFDES METVKIALVGKYTNLKDSYLSVIKALEHSSMKCRRKLDIKWVEATDLEPEAQESNKTKFH EAWNMVSTADGILIPGGFGVRGTEGMVLAARWARENHIPFLGVCLGLQIATIEFTRSVLG RKDSHSAEFYPDIDEKNHVVVFMPEIDKETMGGSMRLGLRPTFFQNETEWSQIKKLYGDV SEVHERHRHRYEINPKMVDELENNGLIFVGKDDTGKRCEILELKNHPYYIATQYHPEYTS KVLDPSKPFLGLVAASAGILQDVIEGKYDLEAGENKFNF
References
External Links
ResourceLink
Saccharomyces Genome Database URA7
Uniprot IDP28274
Uniprot NameURA7_YEAST
GenBank Gene IDX53995
Genebank Protein ID440583
General Reference
  • Ozier-Kalogeropoulos, O., Fasiolo, F., Adeline, M. T., Collin, J., Lacroute, F. (1991). "Cloning, sequencing and characterization of the Saccharomyces cerevisiae URA7 gene encoding CTP synthetase." Mol Gen Genet 231:7-16.1753946
  • De Wergifosse, P., Jacques, B., Jonniaux, J. L., Purnelle, B., Skala, J., Goffeau, A. (1994). "The sequence of a 22.4 kb DNA fragment from the left arm of yeast chromosome II reveals homologues to bacterial proline synthetase and murine alpha-adaptin, as well as a new permease and a DNA-binding protein." Yeast 10:1489-1496.7871888
  • Feldmann, H., Aigle, M., Aljinovic, G., Andre, B., Baclet, M. C., Barthe, C., Baur, A., Becam, A. M., Biteau, N., Boles, E., Brandt, T., Brendel, M., Bruckner, M., Bussereau, F., Christiansen, C., Contreras, R., Crouzet, M., Cziepluch, C., Demolis, N., Delaveau, T., Doignon, F., Domdey, H., Dusterhus, S., Dubois, E., Dujon, B., El Bakkoury, M., Entian, K. D., Feurmann, M., Fiers, W., Fobo, G. M., Fritz, C., Gassenhuber, H., Glandsdorff, N., Goffeau, A., Grivell, L. A., de Haan, M., Hein, C., Herbert, C. J., Hollenberg, C. P., Holmstrom, K., Jacq, C., Jacquet, M., Jauniaux, J. C., Jonniaux, J. L., Kallesoe, T., Kiesau, P., Kirchrath, L., Kotter, P., Korol, S., Liebl, S., Logghe, M., Lohan, A. J., Louis, E. J., Li, Z. Y., Maat, M. J., Mallet, L., Mannhaupt, G., Messenguy, F., Miosga, T., Molemans, F., Muller, S., Nasr, F., Obermaier, B., Perea, J., Pierard, A., Piravandi, E., Pohl, F. M., Pohl, T. M., Potier, S., Proft, M., Purnelle, B., Ramezani Rad, M., Rieger, M., Rose, M., Schaaff-Gerstenschlager, I., Scherens, B., Schwarzlose, C., Skala, J., Slonimski, P. P., Smits, P. H., Souciet, J. L., Steensma, H. Y., Stucka, R., Urrestarazu, A., van der Aart, Q. J., van Dyck, L., Vassarotti, A., Vetter, I., Vierendeels, F., Vissers, S., Wagner, G., de Wergifosse, P., Wolfe, K. H., Zagulski, M., Zimmermann, F. K., Mewes, H. W., Kleine, K. (1994). "Complete DNA sequence of yeast chromosome II." EMBO J 13:5795-5809.7813418
  • Yang, W. L., McDonough, V. M., Ozier-Kalogeropoulos, O., Adeline, M. T., Flocco, M. T., Carman, G. M. (1994). "Purification and characterization of CTP synthetase, the product of the URA7 gene in Saccharomyces cerevisiae." Biochemistry 33:10785-10793.8075080
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Peng, J., Schwartz, D., Elias, J. E., Thoreen, C. C., Cheng, D., Marsischky, G., Roelofs, J., Finley, D., Gygi, S. P. (2003). "A proteomics approach to understanding protein ubiquitination." Nat Biotechnol 21:921-926.12872131