You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameDihydroorotate dehydrogenase
Synonyms
  • DHOD
  • DHODase
  • DHOdehase
  • Dihydroorotate oxidase
Gene NameURA1
Enzyme Class
Biological Properties
General FunctionInvolved in catalytic activity
Specific FunctionIn the de novo pyrimidine biosynthesic pathway, catalyzes the stereospecific oxidation of (S)-dihydroorotate to orotate and the reduction of fumarate to succinate. Does not use oxaloacetate and NAD or NADP as electron acceptors
Cellular LocationCytoplasm
SMPDB Pathways
Pyrimidine metabolismPW002469 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Pyrimidine metabolismec00240 Map00240
SMPDB ReactionsNot Available
KEGG Reactions
Ubiquinone-6 + L-Dihydroorotic acidUbiquinol-6 + Orotic acid
L-Dihydroorotic acid + oxygenOrotic acid + Hydrogen peroxide
Fumaric acid + L-Dihydroorotic acidOrotic acid + Succinic acid
Metabolites
YMDB IDNameView
YMDB00101Fumaric acidShow
YMDB00338Succinic acidShow
YMDB00396L-Dihydroorotic acidShow
YMDB00405Orotic acidShow
YMDB00660Ubiquinone-6Show
YMDB00888Hydrogen peroxideShow
YMDB00900oxygenShow
YMDB00915Ubiquinol-6Show
GO Classification
Component
intracellular part
cytoplasm
cell part
Function
oxidoreductase activity
oxidoreductase activity, acting on the CH-CH group of donors
dihydroorotate oxidase activity
oxidoreductase activity, acting on the CH-CH group of donors, quinone or related compound as acceptor
dihydroorotate dehydrogenase activity
catalytic activity
Process
nitrogen compound metabolic process
oxidation reduction
cellular nitrogen compound metabolic process
pyrimidine nucleoside monophosphate biosynthetic process
nucleobase, nucleoside, nucleotide and nucleic acid metabolic process
pyrimidine ribonucleoside monophosphate biosynthetic process
nucleobase, nucleoside and nucleotide metabolic process
UMP biosynthetic process
nucleoside phosphate metabolic process
nucleotide metabolic process
cellular metabolic process
cellular aromatic compound metabolic process
nucleobase metabolic process
pyrimidine base metabolic process
pyrimidine base biosynthetic process
'de novo' pyrimidine base biosynthetic process
metabolic process
pyrimidine nucleotide metabolic process
pyrimidine nucleotide biosynthetic process
Gene Properties
Chromosome Locationchromosome 11
LocusYKL216W
Gene Sequence>945 bp ATGACAGCCAGTTTAACTACCAAGTTCTTGAACAATACCTATGAAAACCCATTTATGAAT GCATCCGGTGTTCATTGCATGACTACACAAGAATTAGATGAATTAGCAAACTCTAAAGCT GGCGCATTCATTACAAAGAGTGCTACAACCTTAGAAAGAGAAGGTAACCCTGAACCACGT TACATTTCTGTCCCTCTAGGCAGTATCAACTCCATGGGTTTACCAAACGAAGGTATCGAC TACTATTTGTCCTATGTATTAAACCGTCAAAAGAATTATCCTGATGCACCTGCTATTTTC TTCTCAGTTGCTGGTATGAGCATTGATGAAAATTTAAATTTGTTGAGGAAAATCCAAGAT AGCGAATTCAACGGTATTACCGAGTTAAACTTGTCTTGTCCTAATGTGCCTGGGAAACCA CAAGTTGCTTATGACTTTGACTTGACAAAGGAAACCTTGGAAAAGGTTTTTGCCTTTTTC AAAAAACCTCTTGGTGTCAAGTTGCCTCCTTATTTTGATTTTGCCCATTTTGATATCATG GCAAAAATATTGAACGAGTTCCCATTAGCTTATGTCAACTCTATCAATAGTATAGGAAAT GGTCTTTTCATTGATGTGGAGAAGGAGAGTGTAGTAGTGAAGCCAAAGAATGGTTTCGGG GGTATTGGAGGTGAATATGTTAAGCCAACCGCGCTCGCCAATGTTCGTGCATTTTACACT CGTTTGAGACCTGAAATCAAAGTTATCGGTACAGGTGGAATTAAGTCCGGTAAGGATGCA TTTGAACATCTTCTATGTGGTGCCTCTATGCTACAGATTGGTACAGAATTACAAAAAGAG GGCGTCAAGATTTTTGAACGTATCGAAAAAGAATTAAAAGACATAATGGAAGCTAAGGGT TATACATCCATAGATCAGTTCCGTGGGAAGTTGAACAGCATTTAA
Protein Properties
Pfam Domain Function
Protein Residues314
Protein Molecular Weight34800.60156
Protein Theoretical pI5.85
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Dihydroorotate dehydrogenase MTASLTTKFLNNTYENPFMNASGVHCMTTQELDELANSKAGAFITKSATTLEREGNPEPR YISVPLGSINSMGLPNEGIDYYLSYVLNRQKNYPDAPAIFFSVAGMSIDENLNLLRKIQD SEFNGITELNLSCPNVPGKPQVAYDFDLTKETLEKVFAFFKKPLGVKLPPYFDFAHFDIM AKILNEFPLAYVNSINSIGNGLFIDVEKESVVVKPKNGFGGIGGEYVKPTALANVRAFYT RLRPEIKVIGTGGIKSGKDAFEHLLCGASMLQIGTELQKEGVKIFERIEKELKDIMEAKG YTSIDQFRGKLNSI
References
External Links
ResourceLink
Saccharomyces Genome Database URA1
Uniprot IDP28272
Uniprot NamePYRD_YEAST
GenBank Gene IDAJ585637
Genebank Protein ID45719878
General Reference
  • Dujon, B., Alexandraki, D., Andre, B., Ansorge, W., Baladron, V., Ballesta, J. P., Banrevi, A., Bolle, P. A., Bolotin-Fukuhara, M., Bossier, P., et, a. l. .. (1994). "Complete DNA sequence of yeast chromosome XI." Nature 369:371-378.8196765
  • Tzermia, M., Horaitis, O., Alexandraki, D. (1994). "The complete sequencing of a 24.6 kb segment of yeast chromosome XI identified the known loci URA1, SAC1 and TRP3, and revealed 6 new open reading frames including homologues to the threonine dehydratases, membrane transporters, hydantoinases and the phospholipase A2-activating protein." Yeast 10:663-679.7941750
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Jund, R., Lacroute, F. (1972). "Regulation of orotidylic acid pyrophosphorylase in Saccharomyces cerevisiae." J Bacteriol 109:196-202.4550660
  • Roy, A. (1992). "Nucleotide sequence of the URA1 gene of Saccharomyces cerevisiae." Gene 118:149-150.1511880
  • Nagy, M., Lacroute, F., Thomas, D. (1992). "Divergent evolution of pyrimidine biosynthesis between anaerobic and aerobic yeasts." Proc Natl Acad Sci U S A 89:8966-8970.1409592
  • Jordan, D. B., Bisaha, J. J., Picollelli, M. A. (2000). "Catalytic properties of dihydroorotate dehydrogenase from Saccharomyces cerevisiae: studies on pH, alternate substrates, and inhibitors." Arch Biochem Biophys 378:84-92.10871048
  • Gojkovic, Z., Knecht, W., Zameitat, E., Warneboldt, J., Coutelis, J. B., Pynyaha, Y., Neuveglise, C., Moller, K., Loffler, M., Piskur, J. (2004). "Horizontal gene transfer promoted evolution of the ability to propagate under anaerobic conditions in yeasts." Mol Genet Genomics 271:387-393.15014982
  • Zameitat, E., Pierik, A. J., Zocher, K., Loffler, M. (2007). "Dihydroorotate dehydrogenase from Saccharomyces cerevisiae: spectroscopic investigations with the recombinant enzyme throw light on catalytic properties and metabolism of fumarate analogues." FEMS Yeast Res 7:897-904.17617217
  • Zameitat, E., Knecht, W., Piskur, J., Loffler, M. (2004). "Two different dihydroorotate dehydrogenases from yeast Saccharomyces kluyveri." FEBS Lett 568:129-134.15196933
  • Leh-Louis, V., Wirth, B., Despons, L., Wain-Hobson, S., Potier, S., Souciet, J. L. (2004). "Differential evolution of the Saccharomyces cerevisiae DUP240 paralogs and implication of recombination in phylogeny." Nucleic Acids Res 32:2069-2078.15087486