You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameGlycolipid 2-alpha-mannosyltransferase
Synonyms
  • Alpha-1,2-mannosyltransferase
Gene NameKRE2
Enzyme Class
Biological Properties
General FunctionInvolved in mannosyltransferase activity
Specific FunctionRequired for the attachment of the third mannose residue of O-linked saccharides
Cellular LocationGolgi apparatus membrane; Single-pass type II membrane protein
SMPDB Pathways
N-Glycan biosynthesisPW002501 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
N-Glycan biosynthesisec00510 Map00510
SMPDB ReactionsNot Available
KEGG Reactions
Beta-1,4-D-Mannosylchitobiosyldiphosphodolichol + Guanosine diphosphate mannosealpha-D-mannosyl-beta-D-mannosyldiacetylchitobiosyldiphosphodolichol + hydron + Guanosine diphosphate
Metabolites
YMDB IDNameView
YMDB00202Guanosine diphosphate mannoseShow
YMDB00257Guanosine diphosphateShow
YMDB00581alpha-D-mannosyl-beta-D-mannosyldiacetylchitobiosyldiphosphodolicholShow
YMDB00862hydronShow
YMDB00935beta-D-mannosyldiacetylchitobiosyldiphosphodolicholShow
GO Classification
Component
membrane
cell part
Function
alpha-1,2-mannosyltransferase activity
glycolipid 2-alpha-mannosyltransferase activity
catalytic activity
transferase activity
transferase activity, transferring glycosyl groups
transferase activity, transferring hexosyl groups
mannosyltransferase activity
Process
metabolic process
macromolecule metabolic process
macromolecule modification
protein modification process
protein amino acid glycosylation
Gene Properties
Chromosome Locationchromosome 4
LocusYDR483W
Gene Sequence>1329 bp ATGGCCCTCTTTCTCAGTAAGAGACTGTTGAGATTTACCGTCATTGCAGGTGCGGTTATT GTTCTCCTCCTAACATTGAATTCCAACAGTAGAACTCAGCAATATATTCCGAGTTCCATC TCCGCTGCATTTGATTTTACCTCAGGATCTATATCCCCTGAACAACAAGTCATCTCTGAG GAAAATGATGCTAAAAAATTAGAGCAAAGTGCTCTGAATTCAGAGGCAAGCGAAGACTCC GAAGCCATGGATGAAGAATCCAAGGCTCTGAAAGCTGCCGCTGAAAAGGCAGATGCCCCG ATCGACACTAAAACAACCATGGATTATATCACTCCATCTTTTGCTAACAAAGCTGGTAAG CCAAAAGCTTGTTACGTCACTTTGGTGAGAAACAAGGAGTTGAAAGGTTTGCTAAGCTCC ATTAAATATGTGGAAAACAAAATTAACAAGAAATTCCCATATCCTTGGGTTTTCCTAAAC GATGAACCTTTTACTGAAGAATTCAAGGAAGCAGTCACCAAAGCTGTTTCTTCCGAAGTT AAGTTTGGTATTTTGCCCAAGGAACATTGGTCATATCCTGAATGGATTAATCAAACCAAG GCTGCTGAAATTCGTGCAGATGCTGCCACCAAATACATATACGGTGGCTCCGAATCTTAT AGACACATGTGTCGTTACCAATCTGGGTTTTTCTGGAGACATGAATTATTAGAAGAGTAC GATTGGTACTGGCGTGTGGAACCAGACATCAAGTTATACTGTGATATTAATTACGACGTT TTTAAGTGGATGCAAGAAAACGAAAAAGTTTACGGCTTTACCGTTTCTATTCATGAATAT GAAGTGACGATCCCAACACTATGGCAAACGTCCATGGATTTCATCAAAAAGAACCCCGAA TACTTAGATGAAAACAACCTGATGAGTTTTCTTTCGAACGATAATGGTAAAACATACAAT CTGTGCCATTTCTGGTCAAACTTTGAAATTGCAAACTTGAATTTGTGGAGGTCACCAGCC TACAGAGAGTATTTTGACACTTTGGATCATCAAGGTGGATTTTTCTACGAAAGATGGGGC GATGCTCCCGTTCATTCTATTGCTGCTGCTTTGTTTTTGCCAAAGGATAAAATCCATTAT TTTTCAGACATTGGTTACCATCATCCACCTTATGATAACTGCCCATTGGACAAGGAGGTC TATAACAGTAACAACTGTGAATGTGACCAAGGTAATGATTTCACTTTCCAAGGTTACTCT TGTGGTAAGGAATATTATGATGCTCAAGGGTTGGTAAAGCCAAAAAACTGGAAAAAATTC CGTGAGTAG
Protein Properties
Pfam Domain Function
Protein Residues442
Protein Molecular Weight51386.19922
Protein Theoretical pI5.07
PDB Fileshow
Signalling Regions
  • None
Transmembrane Regions
  • 12-30
Protein Sequence>Glycolipid 2-alpha-mannosyltransferase MALFLSKRLLRFTVIAGAVIVLLLTLNSNSRTQQYIPSSISAAFDFTSGSISPEQQVISE ENDAKKLEQSALNSEASEDSEAMDEESKALKAAAEKADAPIDTKTTMDYITPSFANKAGK PKACYVTLVRNKELKGLLSSIKYVENKINKKFPYPWVFLNDEPFTEEFKEAVTKAVSSEV KFGILPKEHWSYPEWINQTKAAEIRADAATKYIYGGSESYRHMCRYQSGFFWRHELLEEY DWYWRVEPDIKLYCDINYDVFKWMQENEKVYGFTVSIHEYEVTIPTLWQTSMDFIKKNPE YLDENNLMSFLSNDNGKTYNLCHFWSNFEIANLNLWRSPAYREYFDTLDHQGGFFYERWG DAPVHSIAAALFLPKDKIHYFSDIGYHHPPYDNCPLDKEVYNSNNCECDQGNDFTFQGYS CGKEYYDAQGLVKPKNWKKFRE
References
External Links
ResourceLink
Saccharomyces Genome Database KRE2
Uniprot IDP27809
Uniprot NameKRE2_YEAST
GenBank Gene IDM81110
Genebank Protein ID171961
PDB ID
1S4P
General Reference
  • Hausler, A., Robbins, P. W. (1992). "Glycosylation in Saccharomyces cerevisiae: cloning and characterization of an alpha-1,2-mannosyltransferase structural gene." Glycobiology 2:77-84.1550992
  • Hill, K., Boone, C., Goebl, M., Puccia, R., Sdicu, A. M., Bussey, H. (1992). "Yeast KRE2 defines a new gene family encoding probable secretory proteins, and is required for the correct N-glycosylation of proteins." Genetics 130:273-283.1541391
  • Jacq, C., Alt-Morbe, J., Andre, B., Arnold, W., Bahr, A., Ballesta, J. P., Bargues, M., Baron, L., Becker, A., Biteau, N., Blocker, H., Blugeon, C., Boskovic, J., Brandt, P., Bruckner, M., Buitrago, M. J., Coster, F., Delaveau, T., del Rey, F., Dujon, B., Eide, L. G., Garcia-Cantalejo, J. M., Goffeau, A., Gomez-Peris, A., Zaccaria, P., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV." Nature 387:75-78.9169867
  • Kolling, R., Lee, A., Chen, E. Y., Botstein, D. (1994). "Nucleotide sequence of the SAC2 gene of Saccharomyces cerevisiae." Yeast 10:1211-1216.7754710
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106