Canmetcon
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameHexaprenyldihydroxybenzoate methyltransferase, mitochondrial
Synonyms
  • 3,4-dihydroxy-5-hexaprenylbenzoate methyltransferase
  • DHHB methyltransferase
  • DHHB-MT
  • DHHB-MTase
  • Dihydroxyhexaprenylbenzoate methyltransferase
Gene NameCOQ3
Enzyme Class
Biological Properties
General FunctionInvolved in methyltransferase activity
Specific FunctionNon-specific O-methyltransferase that catalyzes the 2 O- methylation steps in the ubiquinone biosynthetic pathway
Cellular LocationMitochondrion inner membrane; Peripheral membrane protein; Matrix side
SMPDB PathwaysNot Available
KEGG Pathways
Ubiquinone and other terpenoid-quinone biosynthesisec00130 Map00130
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00198S-AdenosylhomocysteineShow
YMDB00297S-AdenosylmethionineShow
YMDB00438S-Adenosyl-L-methionineShow
YMDB004603-Hexaprenyl-4,5-dihydroxybenzoic acidShow
YMDB004613-Hexaprenyl-4-hydroxy-5-methoxybenzoic acidShow
YMDB009532-Hexaprenyl-3-methyl-5-hydroxy-6-methoxy-1,4-benzoquinolShow
GO Classification
Component
Not Available
Function
quinone cofactor methyltransferase activity
catalytic activity
2-polyprenyl-6-methoxy-1,4-benzoquinone methyltransferase activity
transferase activity
transferase activity, transferring one-carbon groups
methyltransferase activity
C-methyltransferase activity
Process
oxidoreduction coenzyme metabolic process
metabolic process
ubiquinone metabolic process
ubiquinone biosynthetic process
cellular metabolic process
cofactor metabolic process
coenzyme metabolic process
Gene Properties
Chromosome Locationchromosome 15
LocusYOL096C
Gene Sequence>951 bp ATGGGATTCATAATGTTGTTAAGATCTAGATTTTTGAAGGTTATTCATGTGAGGAAACAA TTGAGCGCCTGTTCAAGATTTGCAATTCAAACACAAACGAGATGTAAGAGCACAGATGCT TCTGAAGATGAAGTGAAGCATTTCCAGGAGCTAGCCCCTACTTGGTGGGATACAGACGGA TCACAAAGAATTCTACACAAAATGAATCTAACTAGGTTAGATTTTGTGCAGAGGACTGTG AGGAACCAGGTTAAAATTCAGAATCCTGAAATATTTGTCCCTGGATTTAATTACAAGGAG TTTCTACCAGAATACGTCTGCGACAATATTCAGCGGGAAATGCAGGAAAGCATAGAGACT AATCTAGATAAGAGGCCAGAAGTGAGCGTCTTGGATGTTGGATGCGGTGGTGGCATTTTG AGTGAATCGCTCGCGAGACTAAAATGGGTGAAGAATGTTCAAGGGATCGATCTGACTCGC GATTGTATCATGGTAGCAAAAGAGCATGCCAAGAAAGACCCCATGCTGGAGGGAAAGATA AATTATGAGTGCAAGGCTCTGGAGGATGTTACTGGACAATTTGATATTATCACCTGTATG GAAATGCTAGAGCACGTGGATATGCCTAGTGAAATTTTAAGGCATTGTTGGTCGAGGTTA AATCCCGAAAAAGGTATACTCTTTTTAAGTACTATAAACAGAGATCTCATCTCATGGTTT ACTACAATTTTTATGGGTGAAAACGTCTTGAAGATCGTCCCAAAGGGTACTCATCATTTG AGCAAATACATAAACTCAAAGGAAATCCTTGCCTGGTTCAATGACAACTACAGTGGCCAA TTTCGCTTGTTGGATCTCAAGGGGACCATGTACCTCCCATATCAAGGGTGGGTTGAGCAC GATTGTTCCGATGTCGGTAATTATTTTATGGCTATTCAGAGACTGAATTGA
Protein Properties
Pfam Domain Function
Protein Residues312
Protein Molecular Weight36330.60156
Protein Theoretical pI6.98
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Hexaprenyldihydroxybenzoate methyltransferase, mitochondrial MLLRSRFLKVIHVRKQLSACSRFAIQTQTRCKSTDASEDEVKHFQELAPTWWDTDGSQRI LHKMNLTRLDFVQRTVRNQVKIQNPEIFVPGFNYKEFLPEYVCDNIQREMQESIETNLDK RPEVSVLDVGCGGGILSESLARLKWVKNVQGIDLTRDCIMVAKEHAKKDPMLEGKINYEC KALEDVTGQFDIITCMEMLEHVDMPSEILRHCWSRLNPEKGILFLSTINRDLISWFTTIF MGENVLKIVPKGTHHLSKYINSKEILAWFNDNYSGQFRLLDLKGTMYLPYQGWVEHDCSD VGNYFMAIQRLN
References
External Links
ResourceLink
Saccharomyces Genome Database COQ3
Uniprot IDP27680
Uniprot NameCOQ3_YEAST
GenBank Gene IDM73270
Genebank Protein ID171392
General Reference
  • Clarke, C. F., Williams, W., Teruya, J. H. (1991). "Ubiquinone biosynthesis in Saccharomyces cerevisiae. Isolation and sequence of COQ3, the 3,4-dihydroxy-5-hexaprenylbenzoate methyltransferase gene." J Biol Chem 266:16636-16644.1885593
  • Vandenbol, M., Durand, P., Portetelle, D., Hilger, F. (1995). "Sequence analysis of a 44 kb DNA fragment of yeast chromosome XV including the Tyl-H3 retrotransposon, the suf1(+) frameshift suppressor gene for tRNA-Gly, the yeast transfer RNA-Thr-1a and a delta element." Yeast 11:1069-1075.7502582
  • Dujon, B., Albermann, K., Aldea, M., Alexandraki, D., Ansorge, W., Arino, J., Benes, V., Bohn, C., Bolotin-Fukuhara, M., Bordonne, R., Boyer, J., Camasses, A., Casamayor, A., Casas, C., Cheret, G., Cziepluch, C., Daignan-Fornier, B., Dang, D. V., de Haan, M., Delius, H., Durand, P., Fairhead, C., Feldmann, H., Gaillon, L., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XV." Nature 387:98-102.9169874
  • Poon, W. W., Barkovich, R. J., Hsu, A. Y., Frankel, A., Lee, P. T., Shepherd, J. N., Myles, D. C., Clarke, C. F. (1999). "Yeast and rat Coq3 and Escherichia coli UbiG polypeptides catalyze both O-methyltransferase steps in coenzyme Q biosynthesis." J Biol Chem 274:21665-21672.10419476
  • Kellis, M., Patterson, N., Endrizzi, M., Birren, B., Lander, E. S. (2003). "Sequencing and comparison of yeast species to identify genes and regulatory elements." Nature 423:241-254.12748633
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Sickmann, A., Reinders, J., Wagner, Y., Joppich, C., Zahedi, R., Meyer, H. E., Schonfisch, B., Perschil, I., Chacinska, A., Guiard, B., Rehling, P., Pfanner, N., Meisinger, C. (2003). "The proteome of Saccharomyces cerevisiae mitochondria." Proc Natl Acad Sci U S A 100:13207-13212.14576278
  • Marbois, B., Gin, P., Faull, K. F., Poon, W. W., Lee, P. T., Strahan, J., Shepherd, J. N., Clarke, C. F. (2005). "Coq3 and Coq4 define a polypeptide complex in yeast mitochondria for the biosynthesis of coenzyme Q." J Biol Chem 280:20231-20238.15792955