You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NamePhosphoribosylaminoimidazole-succinocarboxamide synthase
Synonyms
  • SAICAR synthetase
Gene NameADE1
Enzyme Class
Biological Properties
General FunctionInvolved in ATP binding
Specific FunctionATP + 5-amino-1-(5-phospho-D- ribosyl)imidazole-4-carboxylate + L-aspartate = ADP + phosphate + (S)-2-(5-amino-1-(5-phospho-D-ribosyl)imidazole-4- carboxamido)succinate
Cellular LocationNot Available
SMPDB PathwaysNot Available
KEGG Pathways
Purine metabolismec00230 Map00230
SMPDB ReactionsNot Available
KEGG Reactions
5-amino-1-(5-phospho-D-ribosyl)imidazole-4-carboxylate + L-Aspartic acid + Adenosine triphosphateSAICAR + phosphate + hydron + ADP
Metabolites
YMDB IDNameView
YMDB000775-amino-1-(5-phospho-D-ribosyl)imidazole-4-carboxylateShow
YMDB00109Adenosine triphosphateShow
YMDB00350SAICARShow
YMDB00561(2S)-2-[5-Amino-1-(5-phospho-beta-D-ribosyl)imidazole-4-carboxamido]succinic acidShow
YMDB00862hydronShow
YMDB00896L-Aspartic acidShow
YMDB00907phosphateShow
YMDB00914ADPShow
GO Classification
Component
Not Available
Function
adenyl ribonucleotide binding
ATP binding
ligase activity
acid-amino acid ligase activity
ligase activity, forming carbon-nitrogen bonds
phosphoribosylaminoimidazolesuccinocarboxamide synthase activity
binding
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
catalytic activity
Process
metabolic process
nitrogen compound metabolic process
cellular nitrogen compound metabolic process
nucleobase, nucleoside, nucleotide and nucleic acid metabolic process
nucleobase, nucleoside and nucleotide metabolic process
nucleoside phosphate metabolic process
nucleotide metabolic process
purine nucleotide metabolic process
purine nucleotide biosynthetic process
Gene Properties
Chromosome Locationchromosome 1
LocusYAR015W
Gene Sequence>921 bp ATGTCAATTACGAAGACTGAACTGGACGGTATATTGCCATTGGTGGCCAGAGGTAAAGTT AGAGACATATATGAGGTAGACGCTGGTACGTTGCTGTTTGTTGCTACGGATCGTATCTCT GCATATGACGTTATTATGGAAAACAGCATTCCTGAAAAGGGGATCCTATTGACCAAACTG TCAGAGTTCTGGTTCAAGTTCCTGTCCAACGATGTTCGTAATCATTTGGTCGACATCGCC CCAGGTAAGACTATTTTCGATTATCTACCTGCAAAATTGAGCGAACCAAAGTACAAAACG CAACTAGAAGACCGCTCTCTATTGGTTCACAAACATAAACTAATTCCATTGGAAGTAATT GTCAGAGGCTACATCACCGGATCTGCTTGGAAAGAGTACGTAAAAACAGGTACTGTGCAT GGTTTGAAACAACCTCAAGGACTTAAAGAATCTCAAGAGTTCCCAGAACCAATCTTCACC CCATCGACCAAGGCTGAACAAGGTGAACATGACGAAAACATCTCTCCTGCCCAGGCCGCT GAGCTGGTGGGTGAAGATTTGTCACGTAGAGTGGCAGAACTGGCTGTAAAACTGTACTCC AAGTGCAAAGATTATGCTAAGGAGAAGGGCATCATCATCGCAGACACTAAATTCGAATTC GGTATTGACGAAAAGACCAATGAAATTATTCTAGTGGACGAGGTGCTAACGCCAGACTCC TCTAGATTCTGGAACGGTGCCTCTTATAAGGTAGGAGAATCCCAAGATTCTTACGATAAG CAATTTTTAAGAGACTGGCTTACTGCTAATAAGTTGAACGGTGTTAACGGCGTCAAAATG CCCCAAGACATTGTCGACAGGACAAGGGCCAAATATATAGAGGCTTATGAAACATTGACA GGGTCTAAATGGTCTCACTAA
Protein Properties
Pfam Domain Function
Protein Residues306
Protein Molecular Weight34603.10156
Protein Theoretical pI5.74
PDB Fileshow
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Phosphoribosylaminoimidazole-succinocarboxamide synthase MSITKTELDGILPLVARGKVRDIYEVDAGTLLFVATDRISAYDVIMENSIPEKGILLTKL SEFWFKFLSNDVRNHLVDIAPGKTIFDYLPAKLSEPKYKTQLEDRSLLVHKHKLIPLEVI VRGYITGSAWKEYVKTGTVHGLKQPQGLKESQEFPEPIFTPSTKAEQGEHDENISPAQAA ELVGEDLSRRVAELAVKLYSKCKDYAKEKGIIIADTKFEFGIDEKTNEIILVDEVLTPDS SRFWNGASYKVGESQDSYDKQFLRDWLTANKLNGVNGVKMPQDIVDRTRAKYIEAYETLT GSKWSH
References
External Links
ResourceLink
Saccharomyces Genome Database ADE1
Uniprot IDP27616
Uniprot NamePUR7_YEAST
GenBank Gene IDL22015
Genebank Protein ID349755
PDB ID
1OBG
General Reference
  • Miasnikov, A. N., Plavnik, I. u. A., Sasnauskas, K. V., Gedminene, G. K., Ianulaitis, A. A. (1986). "[Nucleotide sequence of the ADE 1 gene of the yeast Saccharomyces cerevisiae]." Bioorg Khim 12:555-558.3013210
  • Myasnikov, A. N., Sasnauskas, K. V., Janulaitis, A. A., Smirnov, M. N. (1991). "The Saccharomyces cerevisiae ADE1 gene: structure, overexpression and possible regulation by general amino acid control." Gene 109:143-147.1756975
  • Davies, C. J., Hutchison, C. A. 3rd (1991). "A directed DNA sequencing strategy based upon Tn3 transposon mutagenesis: application to the ADE1 locus on Saccharomyces cerevisiae chromosome I." Nucleic Acids Res 19:5731-5738.1658741
  • Clark, M. W., Keng, T., Storms, R. K., Zhong, W., Fortin, N., Zeng, B., Delaney, S., Ouellette, B. F., Barton, A. B., Kaback, D. B., et, a. l. .. (1994). "Sequencing of chromosome I of Saccharomyces cerevisiae: analysis of the 42 kbp SPO7-CENI-CDC15 region." Yeast 10:535-541.7941740
  • Bussey, H., Kaback, D. B., Zhong, W., Vo, D. T., Clark, M. W., Fortin, N., Hall, J., Ouellette, B. F., Keng, T., Barton, A. B., et, a. l. .. (1995). "The nucleotide sequence of chromosome I from Saccharomyces cerevisiae." Proc Natl Acad Sci U S A 92:3809-3813.7731988
  • Schweitzer, B., Philippsen, P. (1992). "NPK1, a nonessential protein kinase gene in Saccharomyces cerevisiae with similarity to Aspergillus nidulans nimA." Mol Gen Genet 234:164-167.1495480
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956
  • Levdikov, V. M., Barynin, V. V., Grebenko, A. I., Melik-Adamyan, W. R., Lamzin, V. S., Wilson, K. S. (1998). "The structure of SAICAR synthase: an enzyme in the de novo pathway of purine nucleotide biosynthesis." Structure 6:363-376.9551557