You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameUridine kinase
Synonyms
  • Uridine monophosphokinase
Gene NameURK1
Enzyme Class
Biological Properties
General FunctionInvolved in ATP binding
Specific FunctionCatalyzes the conversion of uridine into UMP and cytidine into CMP in the pyrimidine salvage pathway
Cellular LocationCytoplasm. Nucleus
SMPDB Pathways
Pyrimidine metabolismPW002469 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Pyrimidine metabolismec00240 Map00240
SMPDB ReactionsNot Available
KEGG Reactions
GTP + CytidineCytidine monophosphate + hydron + Guanosine diphosphate
Adenosine triphosphate + Uridinehydron + ADP + Uridine 5'-monophosphate
GTP + Uridinehydron + Uridine 5'-monophosphate + Guanosine diphosphate
Metabolites
YMDB IDNameView
YMDB00049Uridine 5'-monophosphateShow
YMDB00051CytidineShow
YMDB00109Adenosine triphosphateShow
YMDB00127UridineShow
YMDB00257Guanosine diphosphateShow
YMDB00406Cytidine monophosphateShow
YMDB00558GTPShow
YMDB00862hydronShow
YMDB00914ADPShow
GO Classification
Component
Not Available
Function
binding
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
ATP binding
catalytic activity
kinase activity
transferase activity
phosphotransferase activity, alcohol group as acceptor
transferase activity, transferring phosphorus-containing groups
Process
metabolic process
Gene Properties
Chromosome Locationchromosome 14
LocusYNR012W
Gene Sequence>1506 bp ATGTCCCATCGTATAGCACCTTCCAAAGAACGATCTTCATCATTTATTTCAATTTTAGAC GATGAAACAAGAGACACATTGAAAGCTAATGCAGTCATGGATGGTGAAGTAGATGTCAAA AAAACAAAAGGAAAAAGCTCTCGGTATATCCCACCATGGACAACTCCATATATAATAGGT ATAGGTGGTGCTTCAGGTTCAGGCAAGACAAGCGTTGCTGCTAAGATTGTGTCGTCAATT AATGTTCCCTGGACAGTATTAATATCTTTGGATAACTTTTACAATCCATTAGGCCCAGAG GACAGAGCCAGAGCCTTTAAAAATGAATACGATTTCGACGAGCCAAATGCCATCAACTTA GATTTGGCATATAAGTGCATTTTGAACTTAAAGGAGGGCAAAAGGACAAATATCCCAGTT TATAGCTTCGTCCACCACAATAGAGTTCCTGATAAAAATATAGTCATATACGGGGCCAGT GTGGTAGTTATCGAAGGGATCTACGCCCTTTACGATCGCCGATTGCTGGATTTGATGGAC TTGAAAATTTATGTTGACGCTGATTTGGATGTCTGCTTAGCAAGAAGATTGTCGAGAGAT ATAGTTTCCAGAGGGAGAGATTTGGATGGTTGTATTCAACAATGGGAGAAATTTGTGAAA CCAAATGCGGTAAAGTTTGTGAAACCAACAATGAAGAATGCAGATGCTATCATTCCATCG ATGAGTGATAATGCTACAGCGGTAAATTTAATCATTAACCACATCAAGTCAAAACTGGAA CTAAAATCAAATGAACACTTAAGAGAGCTAATCAAATTGGGCTCTTCTCCTTCACAAGAT GTGCTTAATCGTAACATAATTCATGAATTGCCGCCCACCAACCAAGTTCTTTCGCTGCAT ACTATGCTTCTAAATAAAAATCTAAATTGCGCGGACTTTGTTTTCTACTTTGACAGGTTA GCAACAATTTTGTTATCATGGGCACTTGATGACATTCCTGTAGCACATACGAACATAATT ACACCTGGTGAGCATACCATGGAAAACGTTATTGCCTGTCAATTCGATCAAGTTACAGCT GTTAATATTATTCGATCTGGCGATTGTTTTATGAAGTCTTTGAGAAAGACGATCCCCAAT ATCACAATTGGTAAATTGTTGATTCAGTCCGATTCACAAACTGGGGAACCTCAACTGCAT TGCGAATTTTTACCCCCAAATATAGAAAAGTTTGGCAAGGTTTTCTTAATGGAAGGTCAA ATCATAAGTGGTGCGGCCATGATCATGGCCATCCAGGTGCTTTTAGATCATGGTATTGAT TTGGAAAAGATTAGCGTGGTGGTTTATTTGGCCACTGAAGTTGGTATCCGACGTATATTA AATGCATTTGATAACAAAGTCAACATTTTTGCTGGTATGATCATCTCCAGAGAAAAGTTA CAAAATCATCAATACAAATGGGCATTGACCAGATTTTTTGATTCAAAGTATTTTGGTTGT GATTGA
Protein Properties
Pfam Domain Function
Protein Residues501
Protein Molecular Weight56295.5
Protein Theoretical pI7.8
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Uridine kinase MSHRIAPSKERSSSFISILDDETRDTLKANAVMDGEVDVKKTKGKSSRYIPPWTTPYIIG IGGASGSGKTSVAAKIVSSINVPWTVLISLDNFYNPLGPEDRARAFKNEYDFDEPNAINL DLAYKCILNLKEGKRTNIPVYSFVHHNRVPDKNIVIYGASVVVIEGIYALYDRRLLDLMD LKIYVDADLDVCLARRLSRDIVSRGRDLDGCIQQWEKFVKPNAVKFVKPTMKNADAIIPS MSDNATAVNLIINHIKSKLELKSNEHLRELIKLGSSPSQDVLNRNIIHELPPTNQVLSLH TMLLNKNLNCADFVFYFDRLATILLSWALDDIPVAHTNIITPGEHTMENVIACQFDQVTA VNIIRSGDCFMKSLRKTIPNITIGKLLIQSDSQTGEPQLHCEFLPPNIEKFGKVFLMEGQ IISGAAMIMAIQVLLDHGIDLEKISVVVYLATEVGIRRILNAFDNKVNIFAGMIISREKL QNHQYKWALTRFFDSKYFGCD
References
External Links
ResourceLink
Saccharomyces Genome Database URK1
Uniprot IDP27515
Uniprot NameURK1_YEAST
GenBank Gene IDX53998
Genebank Protein ID4773
General Reference
  • Kern, L. (1990). "The URK1 gene of Saccharomyces cerevisiae encoding uridine kinase." Nucleic Acids Res 18:5279.2169608
  • Verhasselt, P., Aert, R., Voet, M., Volckaert, G. (1994). "Twelve open reading frames revealed in the 23.6 kb segment flanking the centromere on the Saccharomyces cerevisiae chromosome XIV right arm." Yeast 10:1355-1361.7900425
  • Philippsen, P., Kleine, K., Pohlmann, R., Dusterhoft, A., Hamberg, K., Hegemann, J. H., Obermaier, B., Urrestarazu, L. A., Aert, R., Albermann, K., Altmann, R., Andre, B., Baladron, V., Ballesta, J. P., Becam, A. M., Beinhauer, J., Boskovic, J., Buitrago, M. J., Bussereau, F., Coster, F., Crouzet, M., D'Angelo, M., Dal Pero, F., De Antoni, A., Del Rey, F., Doignon, F., Domdey, H., Dubois, E., Fiedler, T., Fleig, U., Floeth, M., Fritz, C., Gaillardin, C., Garcia-Cantalejo, J. M., Glansdorff, N. N., Goffeau, A., Gueldener, U., Herbert, C., Heumann, K., Heuss-Neitzel, D., Hilbert, H., Hinni, K., Iraqui Houssaini, I., Jacquet, M., Jimenez, A., Jonniaux, J. L., Karpfinger, L., Lanfranchi, G., Lepingle, A., Levesque, H., Lyck, R., Maftahi, M., Mallet, L., Maurer, K. C., Messenguy, F., Mewes, H. W., Mosti, D., Nasr, F., Nicaud, J. M., Niedenthal, R. K., Pandolfo, D., Pierard, A., Piravandi, E., Planta, R. J., Pohl, T. M., Purnelle, B., Rebischung, C., Remacha, M., Revuelta, J. L., Rinke, M., Saiz, J. E., Sartorello, F., Scherens, B., Sen-Gupta, M., Soler-Mira, A., Urbanus, J. H., Valle, G., Van Dyck, L., Verhasselt, P., Vierendeels, F., Vissers, S., Voet, M., Volckaert, G., Wach, A., Wambutt, R., Wedler, H., Zollner, A., Hani, J. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XIV and its evolutionary implications." Nature 387:93-98.9169873
  • Kurtz, J. E., Exinger, F., Erbs, P., Jund, R. (1999). "New insights into the pyrimidine salvage pathway of Saccharomyces cerevisiae: requirement of six genes for cytidine metabolism." Curr Genet 36:130-136.10501935
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Gruhler, A., Olsen, J. V., Mohammed, S., Mortensen, P., Faergeman, N. J., Mann, M., Jensen, O. N. (2005). "Quantitative phosphoproteomics applied to the yeast pheromone signaling pathway." Mol Cell Proteomics 4:310-327.15665377
  • Li, X., Gerber, S. A., Rudner, A. D., Beausoleil, S. A., Haas, W., Villen, J., Elias, J. E., Gygi, S. P. (2007). "Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae." J Proteome Res 6:1190-1197.17330950
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956