You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameProbable mannosyltransferase YUR1
SynonymsNot Available
Gene NameYUR1
Enzyme Class
Biological Properties
General FunctionInvolved in mannosyltransferase activity
Specific FunctionPossible glycosyltransferase involved in N-linked glycosylation
Cellular LocationGolgi apparatus membrane; Single-pass type II membrane protein
SMPDB Pathways
N-Glycan biosynthesisPW002501 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
N-Glycan biosynthesisec00510 Map00510
SMPDB ReactionsNot Available
KEGG Reactions
Beta-1,4-D-Mannosylchitobiosyldiphosphodolichol + Guanosine diphosphate mannosealpha-D-mannosyl-beta-D-mannosyldiacetylchitobiosyldiphosphodolichol + hydron + Guanosine diphosphate
Metabolites
YMDB IDNameView
YMDB00202Guanosine diphosphate mannoseShow
YMDB00257Guanosine diphosphateShow
YMDB00581alpha-D-mannosyl-beta-D-mannosyldiacetylchitobiosyldiphosphodolicholShow
YMDB00862hydronShow
YMDB00935beta-D-mannosyldiacetylchitobiosyldiphosphodolicholShow
GO Classification
Component
cell part
membrane
Function
alpha-1,2-mannosyltransferase activity
glycolipid 2-alpha-mannosyltransferase activity
catalytic activity
transferase activity
transferase activity, transferring glycosyl groups
transferase activity, transferring hexosyl groups
mannosyltransferase activity
Process
metabolic process
macromolecule metabolic process
macromolecule modification
protein modification process
protein amino acid glycosylation
Gene Properties
Chromosome Locationchromosome 10
LocusYJL139C
Gene Sequence>1287 bp ATGGCAAAAGGAGGCTCGCTATACATCGTTGGCATATTCTTACCAATATGGACCTTTATG ATCTATATTTTTGGCAAAGAGTTATTCCTCATACGAAAATACCAAAAGATTGACAGTACG TATACTGCTCTTTCCCAAAGAGTAAAAGAACAATATGATACAAGTCGAAGAAGAAACTAT TTTCCTAAAGTAAAACTTTCCCGCAATAGCTACGACGACTACACTTTAAATTATACCAGA CAGAATGATTCTGATTCTTTTCACCTACGAGAAAATGCAACAATTTTAATGCTGGTGAGA AATTCAGAATTAGAAGGGGCATTGGATTCAATGAGATCATTAGAGGACAGATTTAACAAC AAGTATCATTATGATTGGACTTTTCTAAATGACGTTCCTTTCGATCAAGACTTCATTGAA GCTACAACATCAATGGCGAGTGGGAAGACCCAATATGCTTTAATACCACCAGAAGATTGG AATCGGCCGCAATGGATTAACGATACACTTTTTGAAGAAAGACTTCGAGTCATGGAGGAT GAGGGTGTTTTATATGGGGGATCCAAGTCATATAGAAATATGTGTCGGTTTAATTCTGGT TTTTTTTTCCGGCAGTCAATACTGGACAACTATGATTACTACTTTAGGGTGGAACCCAAT GTCAAGTATTATTGCGATTTCCCATATGACCCGTTCAGAGTTATGAGATTGAAGGGCAAA AAATACGGATTTGTCATATCATTATATGAATATGAAGAAACCATACCAACCTTATGGGAC GCGGTAGAGGAGTATTTAGTGGCCAGCGAAGAGACCATTTTACGTAAAGAGGACAGTGCC TATGCATTTTTGACCGATTCAGGGCTAGTTGGTAAGCATTATCCCGTTGTTGAAGCAAAC TCTGACTACAATTTGTGCCATTTTTGGTCGAATTTTGAGATTGGCGACTTGAATTTCTTC AGAAGTGACGAATATAAGCATTTTTTTGAAACTTTAGATGCCAAGGGCGGATTTTACTAC GAAAGGTGGGGTGACGCACCTGTACATTCAATTGGTGTCTCCCTACTGCTGAGACCTGAC GAAATCATTCATTTTGACGAACTTGGCTATTTTCACTCACCGTTTGGCACCTGTCCAGCA TCTTACGCTGTTAGGCTCGATCAGAGGTGTAGATGCAAAAGCGATGATGAAAGTGTCATA GATATAACCCCACATAGTTGTTTGATGAGATGGTGGAAAAACGGTAGCGGCAAATATTTC TTAAAAGAAGAGCAAGACGAGATTTAA
Protein Properties
Pfam Domain Function
Protein Residues428
Protein Molecular Weight50835.60156
Protein Theoretical pI4.92
Signalling Regions
  • None
Transmembrane Regions
  • 4-24
Protein Sequence>Probable mannosyltransferase YUR1 MAKGGSLYIVGIFLPIWTFMIYIFGKELFLIRKYQKIDSTYTALSQRVKEQYDTSRRRNY FPKVKLSRNSYDDYTLNYTRQNDSDSFHLRENATILMLVRNSELEGALDSMRSLEDRFNN KYHYDWTFLNDVPFDQDFIEATTSMASGKTQYALIPPEDWNRPQWINDTLFEERLRVMED EGVLYGGSKSYRNMCRFNSGFFFRQSILDNYDYYFRVEPNVKYYCDFPYDPFRVMRLKGK KYGFVISLYEYEETIPTLWDAVEEYLVASEETILRKEDSAYAFLTDSGLVGKHYPVVEAN SDYNLCHFWSNFEIGDLNFFRSDEYKHFFETLDAKGGFYYERWGDAPVHSIGVSLLLRPD EIIHFDELGYFHSPFGTCPASYAVRLDQRCRCKSDDESVIDITPHSCLMRWWKNGSGKYF LKEEQDEI
References
External Links
ResourceLink
Saccharomyces Genome Database YUR1
Uniprot IDP26725
Uniprot NameYUR1_YEAST
GenBank Gene IDX58099
Genebank Protein ID4833
General Reference
  • Foreman, P. K., Davis, R. W., Sachs, A. B. (1991). "The Saccharomyces cerevisiae RPB4 gene is tightly linked to the TIF2 gene." Nucleic Acids Res 19:2781.2041753
  • Katsoulou, C., Tzermia, M., Tavernarakis, N., Alexandraki, D. (1996). "Sequence analysis of a 40.7 kb segment from the left arm of yeast chromosome X reveals 14 known genes and 13 new open reading frames including homologues of genes clustered on the right arm of chromosome XI." Yeast 12:787-797.8813765
  • Galibert, F., Alexandraki, D., Baur, A., Boles, E., Chalwatzis, N., Chuat, J. C., Coster, F., Cziepluch, C., De Haan, M., Domdey, H., Durand, P., Entian, K. D., Gatius, M., Goffeau, A., Grivell, L. A., Hennemann, A., Herbert, C. J., Heumann, K., Hilger, F., Hollenberg, C. P., Huang, M. E., Jacq, C., Jauniaux, J. C., Katsoulou, C., Karpfinger-Hartl, L., et, a. l. .. (1996). "Complete nucleotide sequence of Saccharomyces cerevisiae chromosome X." EMBO J 15:2031-2049.8641269
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106