You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameLeucyl-tRNA synthetase, cytoplasmic
Synonyms
  • Leucine--tRNA ligase
  • LeuRS
Gene NameCDC60
Enzyme Class
Biological Properties
General FunctionInvolved in nucleotide binding
Specific FunctionATP + L-leucine + tRNA(Leu) = AMP + diphosphate + L-leucyl-tRNA(Leu)
Cellular LocationCytoplasm
SMPDB PathwaysNot Available
KEGG Pathways
Valine, leucine and isoleucine biosynthesisec00290 Map00290
SMPDB ReactionsNot Available
KEGG Reactions
L-Leucine + Adenosine triphosphate + tRNA(Leu) → Adenosine monophosphate + Pyrophosphate + Leu-tRNA(Leu)
Metabolites
YMDB IDNameView
YMDB00097Adenosine monophosphateShow
YMDB00109Adenosine triphosphateShow
YMDB00219PyrophosphateShow
YMDB00387L-LeucineShow
GO Classification
Component
cell part
intracellular part
cytoplasm
Function
purine nucleoside binding
leucine-tRNA ligase activity
adenyl nucleotide binding
adenyl ribonucleotide binding
ATP binding
ligase activity, forming carbon-oxygen bonds
ligase activity, forming aminoacyl-tRNA and related compounds
catalytic activity
aminoacyl-tRNA ligase activity
nucleotide binding
ligase activity
binding
nucleoside binding
Process
translation
leucyl-tRNA aminoacylation
metabolic process
macromolecule metabolic process
cellular macromolecule metabolic process
RNA metabolic process
ncRNA metabolic process
biosynthetic process
tRNA metabolic process
tRNA aminoacylation
tRNA aminoacylation for protein translation
macromolecule biosynthetic process
cellular macromolecule biosynthetic process
Gene Properties
Chromosome Locationchromosome 16
LocusYPL160W
Gene Sequence>3273 bp ATGTCTTCTGGTTTGGTCTTAGAAAACACGGCACGTAGAGATGCGTTAATCGCCATCGAA AAGAAGTACCAAAAAATATGGGCTGAAGAGCACCAATTTGAAATCGATGCGCCATCAATC GAAGATGAGCCCATTACAATGGACTCTGAAGAGTTACATCGCACGTATCCTAAATTCATG TCGTCTATGGCCTATCCTTATATGAACGGTGTTATGCACGCCGGCCATTGTTTTACTCTC TCCAAAGTCGAATTTTCTATTGGTTTTGAAAGGATGAACGGTAAAAGAGCTTTGTTTCCA TTGGGTTTTCACTGTACAGGTATGCCAATCTTAGCATGTGCCGATAAACTAAAGAGGGAA GCCGAACTTTTTGGCAAGAACTTCGACAATGTACCAGCAGAAGAAGAAGAAATTAAAGAA GAAACGCCGGCTGAGAAAGACCACGAGGATGTTACCAAATTCAAAGCTAAAAAATCTAAA GCCGCAGCCAAGAAGGGCCGTGGTAAGTACCAATTCGAAATCATGTTACAGCTTGGTATC CCTAGAGAAGAAATCATTAAGTTCGCCGACGCCAAGTACTGGTTGACCTATTTCCCACCT TTGTGTGAAAGTGATTGTACTTCACTTGGGGCTCGTATCGATTGGAGACGTTCTTTTGTC ACCACTGATGCCAATCCTTATTACGATGCCTTTATTAGATGGCAAATGAACAAGTTAAAG GCTGCTGGTAAAATCAAATTCGGTGAACGTTATACTATTTACTCTGAAAAAGATGGTCAA GCTTGTATGGATCACGATAGACAATCCGGTGAAGGTGTTACACCACAAGAATATATTGGT GTGAAAATTGAAGCTTTAGAGTTCGCCGATGATGCCGCAAAAATCATTGATTCAAGCTCA GATCTTGACAAATCCAAAAAATTCTACTTTGTCGCTGCCACGTTGAGACCGGAAACTATG TATGGACAAACATGTTGTTTTGTTTCTCCAACAATTGAGTATGGTATATTTGACGCTGGT GATTCTTATTTTATCACTACTGAACGTGCATTCAAGAACATGTCTTACCAAAAGCTAACA CCAAAGAGAGGCTTCTACAAGCCGATAGTTACTGTCCCAGGTAAGGCATTTATCGGTACC AAGATTCATGCCCCACAATCTGTATATCCAGAACTAAGAATATTGCCTATGGAAACTGTC ATTGCTACCAAGGGTACTGGTGTCGTCACGTGTGTACCATCTAATTCACCAGATGACTAC ATTACCACCAAGGACTTGTTGCACAAACCTGAATACTACGGCATTAAACCTGAATGGATT GACCATGAAATTGTTCCAATTATGCATACCGAAAAGTATGGTGATTTAACTGCAAAGGCT ATTGTTGAAGAAAAAAAAATTCAATCTCCAAAGGATAAGAACTTGTTAGCAGAAGCCAAG AAAATTGCTTACAAGGAAGATTACTACACTGGTACCATGATATATGGTCCTTATAAAGGT GAGAAGGTCGAACAAGCCAAAAACAAGGTTAAGGCTGATATGATTGCCGCCGGTGAAGCT TTCGTCTACAACGAACCAGAATCTCAGGTCATGTCACGTTCTGGTGATGACTGTATCGTT TCTTTGGAAGATCAATGGTACGTTGATTACGGTGAAGAAAGTTGGAAGAAACAAGCAATT GAATGTTTGGAAGGGATGCAATTATTTGCTCCTGAGGTAAAAAACGCATTTGAAGGTGTT TTGGATTGGTTGAAAAACTGGGCTGTTTGCCGTACATACGGGTTAGGTACCAGATTGCCT TGGGATGAAAAATACTTAGTTGAGTCTTTATCAGACTCTACTATTTATCAATCATTTTAT ACCATTGCTCACTTACTATTTAAGGATTATTATGGTAACGAAATTGGACCATTAGGCATT TCAGCTGATCAAATGACAGATGAGGTTTTCGATTACATTTTCCAACATCAGGATGATGTC AAGAACACCAATATTCCTTTGCCTGCTTTACAAAAGTTGAGAAGGGAATTTGAGTATTTC TACCCATTAGACGTCTCAATTTCCGGGAAGGATTTGATCCCTAACCATTTAACTTTCTTC ATTTACACACATGTTGCATTATTCCCAAAGAAATTCTGGCCTAAAGGTATCAGAGCTAAC GGTCATTTGATGTTAAACAATTCTAAAATGTCGAAATCTACAGGTAATTTTATGACTTTA GAACAAACGGTTGAAAAGTTCGGTGCTGATGCAGCTCGTATTGCGTTTGCCGATGCGGGA GATACTGTTGAAGATGCAAATTTTGACGAATCTAACGCTAATGCTGCTATTCTGAGATTA TTCAATTTGAAGGAGTGGGCAGAAGAAATTACCAAGGAATCTAACTTGAGAACTGGGGAA ATTACAGATTTCTTTGATATCGCGTTTGAACACGAAATGAATGCTCTGATTGAAAAGACT TATGAACAGTATGCATTGACTAATTATAAGAATGCCTTGAAATACGGTCTTTTTGATTTC CAAGCTGCTAGGGATTACTATCGTGAAGCTAGTGGTGTAATGCATAAAGATTTAATTGCA CGTTATATTGAAACACAAGCCTTATTGCTGGCTCCAATTGCGCCTCATTTCGCTGAGTAT ATTTACCGTGAAGTTCTAGGTAACCAAACCTCTGTACAAAATGCCAAATTTCCACGTGCA TCCAAACCAGTAGATAAGGGTGTTCTGGCTGCTTTGGATTACTTGAGAAATCTACAGAGA AGCATAAGAGAAGGCGAAGGGCAAGCACTAAAAAAGAAGAAGGGCAAGTCTGCTGAAATC GATGCATCCAAACCTGTTAAGTTGACTTTATTGATCTCTGAATCATTTCCAGAATGGCAA TCACAATGCGTGGAAATCGTCCGTAAACTATTCAGCGAACAGACTTTAGACGATAACAAA AAGGTCAGAGAGCATATTGAGCCTAAAGAAATGAAGAGAGCTATGCCATTCATTTCTCTA TTGAAACAACGTTTAGCTAATGAAAAGCCAGAGGATGTGTTTGAAAGAGAGTTACAATTC AGCGAAATCGATACTGTCAAGGCTGCTGCAAGGAATGTTAAGAAGGCAGCACAAGCTTTG AAAATTGCTGAATTTAGCGCAATTTCTTTCCCATATGGCGCCAAAACCGGTAAGGATATC TTTACTGGTGAAGAAGTTGAAATTCCACCTGTAACAAAGATTGTTGAAAATGCTGTTCCA GGTAACCCAGGTGTTGTCTTCCAAAATATTTAA
Protein Properties
Pfam Domain Function
Protein Residues1090
Protein Molecular Weight124140.0
Protein Theoretical pI5.6
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Leucyl-tRNA synthetase, cytoplasmic MSSGLVLENTARRDALIAIEKKYQKIWAEEHQFEIDAPSIEDEPITMDSEELHRTYPKFM SSMAYPYMNGVMHAGHCFTLSKVEFSIGFERMNGKRALFPLGFHCTGMPILACADKLKRE AELFGKNFDNVPAEEEEIKEETPAEKDHEDVTKFKAKKSKAAAKKGRGKYQFEIMLQLGI PREEIIKFADAKYWLTYFPPLCESDCTSLGARIDWRRSFVTTDANPYYDAFIRWQMNKLK AAGKIKFGERYTIYSEKDGQACMDHDRQSGEGVTPQEYIGVKIEALEFADDAAKIIDSSS DLDKSKKFYFVAATLRPETMYGQTCCFVSPTIEYGIFDAGDSYFITTERAFKNMSYQKLT PKRGFYKPIVTVPGKAFIGTKIHAPQSVYPELRILPMETVIATKGTGVVTCVPSNSPDDY ITTKDLLHKPEYYGIKPEWIDHEIVPIMHTEKYGDLTAKAIVEEKKIQSPKDKNLLAEAK KIAYKEDYYTGTMIYGPYKGEKVEQAKNKVKADMIAAGEAFVYNEPESQVMSRSGDDCIV SLEDQWYVDYGEESWKKQAIECLEGMQLFAPEVKNAFEGVLDWLKNWAVCRTYGLGTRLP WDEKYLVESLSDSTIYQSFYTIAHLLFKDYYGNEIGPLGISADQMTDEVFDYIFQHQDDV KNTNIPLPALQKLRREFEYFYPLDVSISGKDLIPNHLTFFIYTHVALFPKKFWPKGIRAN GHLMLNNSKMSKSTGNFMTLEQTVEKFGADAARIAFADAGDTVEDANFDESNANAAILRL FNLKEWAEEITKESNLRTGEITDFFDIAFEHEMNALIEKTYEQYALTNYKNALKYGLFDF QAARDYYREASGVMHKDLIARYIETQALLLAPIAPHFAEYIYREVLGNQTSVQNAKFPRA SKPVDKGVLAALDYLRNLQRSIREGEGQALKKKKGKSAEIDASKPVKLTLLISESFPEWQ SQCVEIVRKLFSEQTLDDNKKVREHIEPKEMKRAMPFISLLKQRLANEKPEDVFERELQF SEIDTVKAAARNVKKAAQALKIAEFSAISFPYGAKTGKDIFTGEEVEIPPVTKIVENAVP GNPGVVFQNI
References
External Links
ResourceLink
Saccharomyces Genome Database CDC60
Uniprot IDP26637
Uniprot NameSYLC_YEAST
GenBank Gene IDX62878
Genebank Protein ID3508
General Reference
  • Hohmann, S., Thevelein, J. M. (1992). "The cell division cycle gene CDC60 encodes cytosolic leucyl-tRNA synthetase in Saccharomyces cerevisiae." Gene 120:43-49.1398122
  • Purnelle, B., Coster, F., Goffeau, A. (1996). "The sequence of 55 kb on the left arm of yeast chromosome XVI identifies a small nuclear RNA, a new putative protein kinase and two new putative regulators." Yeast 12:1483-1492.8948103
  • Bussey, H., Storms, R. K., Ahmed, A., Albermann, K., Allen, E., Ansorge, W., Araujo, R., Aparicio, A., Barrell, B., Badcock, K., Benes, V., Botstein, D., Bowman, S., Bruckner, M., Carpenter, J., Cherry, J. M., Chung, E., Churcher, C., Coster, F., Davis, K., Davis, R. W., Dietrich, F. S., Delius, H., DiPaolo, T., Hani, J., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XVI." Nature 387:103-105.9169875
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956