You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NamePantothenate transporter FEN2
Synonyms
  • Fenpropimorph resistance protein 2
Gene NameFEN2
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in transmembrane transport
Specific FunctionTransports pantothenate into the cell. Also involved in the catabolite repression-mediated regulation of ergosterol biosynthesis and in fenpropimorph resistance
Cellular LocationCell membrane; Multi-pass membrane protein
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00203(R)-Pantothenic acidShow
YMDB00862hydronShow
GO Classification
Component
Not Available
Function
Not Available
Process
transmembrane transport
establishment of localization
transport
Gene Properties
Chromosome Locationchromosome 3
LocusYCR028C
Gene Sequence>1539 bp ATGGTAGCAACAATAATGCAGACGACAACAACTGTGCTGACGACAGTCGCCGCAATGTCT ACTACCTTAGCATCAAATTACATATCTTCGCAAGCTAGTTCCTCGACGAGTGTAACAACA GTAACGACAATAGCGACATCAATACGCTCTACACCGTCTAATCTACTCTTTTCTAATGTG GCGGCTCAGCCAAAATCATCTTCAGCAAGCACAATTGGGCTTTCAATCGGACTTCCCATC GGAATATTCTGTTTCGGATTACTTATCCTTTTGTGTTATTTCTACCTTAAAAGGAATTCG GTGTCCATTTCAAATCCACCCATGTCAGCTACGATTCCAAGGGAAGAGGAATATTGTCGC CGCACTAATTGGTTCTCACGGTTATTTTGGCAGAGTAAGTGTGAGGATCAGAATTCATAT TCTAATCGTGATATTGAGAAGTATAACGACACCCAGTGGACCTCGGGTGATAACATGTCT TCAAAAATACAGTACAAAATTTCCAAACCCATAATACCGCAGCATATACTGACACCTAAG AAAACGGTGAAGAACCCATATGCTTGGTCTGGTAAAAACATTTCGTTAGACCCCAAAGTG AACGAAATGGAGGAAGAGAAAGTTGTGGATGCATTCCTGTATACTAAACCACCGAATATT GTCCATATTGAATCCAGCATGCCCTCGTATAATGATTTACCTTCTCAAAAAACGGTGTCC TCAAAGAAAACTGCGTTAAAAACGAGTGAGAAATGGAGTTACGAATCTCCACTATCTCGA TGGTTCTTGAGGGGTTCTACATACTTTAAGGATTATGGCTTATCAAAGACCTCTTTAAAG ACCCCAACTGGGGCTCCACAACTGAAGCAAATGAAAATGCTCTCCCGGATAAGTAAGGGT TACTTCAATGAGTCAGATATAATGCCTGACGAACGATCGCCCATCTTGGAGTATAATAAC ACGCCTCTGGATGCAAATGACAGTGTGAATAACTTGGGTAATACCACGCCAGATTCACAA ATCACATCTTATCGCAACAATAACATCGATCTAATCACGGCAAGACCCCATTCAGTGATA TACGGTACTACTGCACAACAAACTTTGGAAACCAACTTCAATGATCATCATGACTGCAAT AAAAGCACTGAGAAACACGAGTTGATAATACCCACCCCATCAAAACCACTAAAGAAAAGG AAAAAAAGAAGACAAAGTAAAATGTATCAGCATTTACAACATTTGTCACGTTCTAAACCA TTGCCGCTTACTCCAAACTCCAAATATAATGGGGAGGCTAGCGTCCAATTAGGGAAGACA TATACAGTTATTCAGGATTACGAGCCTAGATTGACAGACGAAATAAGAATCTCGCTGGGT GAAAAAGTTAAAATTCTGGCCACTCATACCGATGGATGGTGTCTGGTAGAAAAGTGTAAT ACACAAAAGGGTTCTATTCACGTCAGTGTTGACGATAAAAGATACCTCAATGAAGATAGA GGCATTGTGCCTGGTGACTGTCTCCAAGAATACGACTGA
Protein Properties
Pfam Domain Function
Protein Residues512
Protein Molecular Weight58256.0
Protein Theoretical pI7.25
Signalling Regions
  • None
Transmembrane Regions
  • 28-48
  • 80-100
  • 103-123
  • 133-153
  • 165-185
  • 199-219
  • 272-292
  • 313-333
  • 343-363
  • 373-393
  • 402-422
  • 435-455
Protein Sequence>Pantothenate transporter FEN2 MMKESKSITQHEVERESVSSKRAIKKRLLLFKIDLFVLSFVCLQYWINYVDRVGFTNAYI SGMKEDLKMVGNDLTVSNTVFMIGYIVGMVPNNLMLLCVPPRIWLSFCTFAWGLLTLGMY KVTSFKHICAIRFFQALFESCTFSGTHFVLGSWYKEDELPIRSAIFTGSGLVGSMFSGFM QTSIFTHLNGRNGLAGWRWLFIIDFCITLPIAIYGFIFFPGLPDQTSAVSKFSMTRYIFN EQELHYARRRLPARDESTRLDWSTIPRVLKRWHWWMFSLVWVLGGENLGFASNSTFALWL QNQKYTLAQRNNYPSGIFAVGIVSTLCSAVYMSKIPRARHWHVSVFISLVMVIVAVLIRA DPLNPKVVFSAQYLGGVAYAGQAVFFSWANIICHADLQERAIVLASMNMFSGAVNAWWSI LFFASDMVPKFERGCYALLATAISSGIVSVVIRSLQIKENLSKKQVPYIDANDMPGEDDD DDNQDNENDGDDESMEVELHNEEMAEISNPFR
References
External Links
ResourceLink
Saccharomyces Genome Database FEN2
Uniprot IDP25621
Uniprot NameFEN2_YEAST
GenBank Gene IDX59720
Genebank Protein ID14588909
General Reference
  • Agostoni Carbone, M. L., Panzeri, L., Muzi Falconi, M., Carcano, C., Plevani, P., Lucchini, G. (1992). "Nucleotide sequence of 9.2 kb left of CRY1 on yeast chromosome III from strain AB972: evidence for a Ty insertion and functional analysis of open reading frame YCR28." Yeast 8:805-812.1332309
  • Oliver, S. G., van der Aart, Q. J., Agostoni-Carbone, M. L., Aigle, M., Alberghina, L., Alexandraki, D., Antoine, G., Anwar, R., Ballesta, J. P., Benit, P., et, a. l. .. (1992). "The complete DNA sequence of yeast chromosome III." Nature 357:38-46.1574125
  • Koonin, E. V., Bork, P., Sander, C. (1994). "Yeast chromosome III: new gene functions." EMBO J 13:493-503.8313894
  • Marcireau, C., Joets, J., Pousset, D., Guilloton, M., Karst, F. (1996). "FEN2: a gene implicated in the catabolite repression-mediated regulation of ergosterol biosynthesis in yeast." Yeast 12:531-539.8771708
  • Stolz, J., Sauer, N. (1999). "The fenpropimorph resistance gene FEN2 from Saccharomyces cerevisiae encodes a plasma membrane H+-pantothenate symporter." J Biol Chem 274:18747-18752.10373490
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Kim, H., Melen, K., Osterberg, M., von Heijne, G. (2006). "A global topology map of the Saccharomyces cerevisiae membrane proteome." Proc Natl Acad Sci U S A 103:11142-11147.16847258