You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameVacuolar basic amino acid transporter 3
SynonymsNot Available
Gene NameVBA3
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in transmembrane transport
Specific FunctionTransporter required for vacuolar uptake of histidine and lysine
Cellular LocationVacuole membrane; Multi-pass membrane protein
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00330L-LysineShow
YMDB00369L-HistidineShow
YMDB00862hydronShow
GO Classification
Component
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
transporter activity
Process
transmembrane transport
establishment of localization
transport
Gene Properties
Chromosome Locationchromosome 3
LocusYCL069W
Gene Sequence>1377 bp ATGAATATGCTCATTGTCGGTAGAGTTGTTGCTAGTGTTGGGGGAAGCGGACTTCAAACG CTTTGCTTTGTTATTGGTTGTACGATGGTTGGTGAAAGGTCACGTCCATTGGTGATTTCC ATCCTAAGTTGTGCATTTGCTGTAGCTGCTATCGTTGGTCCTATAATCGGAGGTGCCTTT ACAACCCATGTTACCTGGAGGTGGTGCTTCTATATCAATCTTCCTATCGGTGGTCTTGCC ATTATTATGTTTTTACTCACATATAAGGCCGAGAATAAGGGTATACTTCAACAAATTAAA GATGCTATAGGAACAATCTCGAGCTTTACTTTTAGTAAGTTCAGACACCAAGTTAATTTT AAAAGACTTATGAATGGCATAATCTTCAAGTTTGACTTCTTTGGTTTTGCCCTCTGCTCT GCAGGGCTGGTCCTTTTCCTACTGGGGCTAACCTTTGGTGGTAATAAATATAGTTGGAAC TCTGGCCAAGTCATCGCATATTTGGTTTTGGGTGTCTTACTTTTTATTTTTTCATTGGTG TACGATTTCTTCTTATTCGATAAATTCAACCCGGAACCTGATAATATATCCTACAGGCCT CTCCTTCTAAGAAGATTGGTAGCAAAACCAGCCATAATAATAATAAACATGGTAACATTT CTATTATGTACCGGTTACAATGGGCAAATGATATACTCTGTCCAGTTTTTCCAACTTATA TTTGCGTCGAGTGCATGGAAAGCCGGTCTTCACTTGATACCAATCGTTATTACCAACGTT ATTGCGGCCATTGCAAGTGGTGTGATTACCAAAAAGCTCGGTTTAGTTAAACCACTCTTA ATATTTGGAGGCGTTCTTGGGGTAATTGGAGCAGGGCTTATGACACTTATGACAAATACG TCCACGAAGTCAACTCAAATTGGTGTTTTGCTATTACCGGGGTTTTCCCTTGGATTTGCT CTACAAGCATCGCTCATGAGTGCACAGCTTCAAATTACCAAAGATCGTCCAGAAGCTGCT ATGGACTTTATTGAAGTAACAGCTTTCAATACATTCATGAAGTCATTAGGTACAACTCTT GGTGGTGTGCTTTCAACCACTGTTTTTTCCGCCTCCTTTCACAACAAAGTATCACGAGCT CATCTAGAGCCTTACGAAGGAAAAACGGTTGATGACATGATTTTGTATCGTCTTCAAAAC TACGACGGTTCTCATTCGACTATTGGAAACATTTTAAGCGACTCCATTAAGAACGTATTT TGGATGGATCTAGGGTTTTATGCCTTAGGATTTTTGTTTTGTAGTTTTTCATCCAATAAG AAATTAATCATACCAAAAAAGGACGAGACACCAGAAGATAATTTAGAAGACAAGTAG
Protein Properties
Pfam Domain Function
Protein Residues458
Protein Molecular Weight50224.89844
Protein Theoretical pI9.52
Signalling Regions
  • None
Transmembrane Regions
  • 10-30
  • 37-57
  • 68-88
  • 133-153
  • 164-184
  • 206-226
  • 249-269
  • 278-298
  • 307-327
  • 416-436
Protein Sequence>Vacuolar basic amino acid transporter 3 MNMLIVGRVVASVGGSGLQTLCFVIGCTMVGERSRPLVISILSCAFAVAAIVGPIIGGAF TTHVTWRWCFYINLPIGGLAIIMFLLTYKAENKGILQQIKDAIGTISSFTFSKFRHQVNF KRLMNGIIFKFDFFGFALCSAGLVLFLLGLTFGGNKYSWNSGQVIAYLVLGVLLFIFSLV YDFFLFDKFNPEPDNISYRPLLLRRLVAKPAIIIINMVTFLLCTGYNGQMIYSVQFFQLI FASSAWKAGLHLIPIVITNVIAAIASGVITKKLGLVKPLLIFGGVLGVIGAGLMTLMTNT STKSTQIGVLLLPGFSLGFALQASLMSAQLQITKDRPEAAMDFIEVTAFNTFMKSLGTTL GGVLSTTVFSASFHNKVSRAHLEPYEGKTVDDMILYRLQNYDGSHSTIGNILSDSIKNVF WMDLGFYALGFLFCSFSSNKKLIIPKKDETPEDNLEDK
References
External Links
ResourceLink
Saccharomyces Genome Database VBA3
Uniprot IDP25594
Uniprot NameVBA3_YEAST
GenBank Gene IDX59720
Genebank Protein ID5290
General Reference
  • Oliver, S. G., van der Aart, Q. J., Agostoni-Carbone, M. L., Aigle, M., Alberghina, L., Alexandraki, D., Antoine, G., Anwar, R., Ballesta, J. P., Benit, P., et, a. l. .. (1992). "The complete DNA sequence of yeast chromosome III." Nature 357:38-46.1574125
  • Shimazu, M., Sekito, T., Akiyama, K., Ohsumi, Y., Kakinuma, Y. (2005). "A family of basic amino acid transporters of the vacuolar membrane from Saccharomyces cerevisiae." J Biol Chem 280:4851-4857.15572352
  • Kim, H., Melen, K., Osterberg, M., von Heijne, G. (2006). "A global topology map of the Saccharomyces cerevisiae membrane proteome." Proc Natl Acad Sci U S A 103:11142-11147.16847258